KEGG   Danio rerio (zebrafish): 325084Help
Entry
325084            CDS       T01004                                 

Gene name
src
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04137  Mitophagy - animal
dre04144  Endocytosis
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04520  Adherens junction
dre04530  Tight junction
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04912  GnRH signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    325084 (src)
   04370 VEGF signaling pathway
    325084 (src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    325084 (src)
   04137 Mitophagy - animal
    325084 (src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    325084 (src)
   04520 Adherens junction
    325084 (src)
   04530 Tight junction
    325084 (src)
   04540 Gap junction
    325084 (src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    325084 (src)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    325084 (src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    325084 (src)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    325084 (src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    325084 (src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    325084 (src)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     325084 (src)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  SRC family
   325084 (src)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    325084 (src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    325084 (src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    325084 (src)
  Macropinocytosis
   Kinases
    325084 (src)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase zf-RING_14 hSH3 SH3_3 APH SH3_10
Motif
Other DBs
NCBI-GeneID: 325084
NCBI-ProteinID: NP_001003837
ZFIN: ZDB-GENE-030131-3809
Ensembl: ENSDARG00000008107
Vega: OTTDARG00000021257
UniProt: Q1JPZ3 B2GS52
Position
23
AA seq 534 aa AA seqDB search
MGGAKSKPKELGQRSRSLDDGTGGHHHHTPNPTSFTPNRSPPVEGSRRGTQPNIINAEQA
LFGGVNSTTNSITSPNRIGILGGVTTFVALYDYESRTASDLSFRKGERLQIVNNTEGDWW
LARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLNMENRRGTFLVRESET
TKGAYCLSVLDYDNVKGLNVKHYKIRKLDSGGFYITSRTQFSTLQQLVNHYRQHADGLCH
SLTDVCPVLKPPTQGLARDAWEIPRDSLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKP
GTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMGQGSLLDFLKGDMGKMLR
LPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGY
RMPCPAECPDSLHELMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQYQPGENL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggtggagccaagagtaaacccaaagagctgggccagcgctcgcggagtctggacgat
ggcaccggaggacaccaccaccacacccccaaccccacctccttcacccctaaccgcagt
ccaccagtagaggggtcccggcgcggcacacagcccaacatcatcaacgcggagcaggcg
ctctttgggggagtgaactccaccaccaacagcatcacatctcctaatcgaatcggcata
ttaggcggcgtgaccacatttgtggctctgtatgactacgagtcacgaaccgcctccgat
ttgtcattcaggaaaggagaacgactccagattgtcaataacacggagggtgactggtgg
ctagcgcgatcactgacgacaggagagagcggatacattcccagcaattacgtggcaccg
tctgactccatccaggctgaagaatggtactttggaaaaatcacacgcagagactctgag
cgactgctcttgaatatggagaacagacgaggaactttcctggtcagagagagcgagacc
accaaaggtgcctactgtctctccgtcctggattatgacaacgtgaagggcctgaatgtg
aaacattataagatccgcaagctggacagcggtggattttacatcacgtcccgcacacag
ttcagcacgttacagcagctggtcaaccactaccgccagcacgcagacggcctgtgccac
tccctgactgacgtgtgtccagtgctgaagcctccgactcagggtctggcacgtgatgcc
tgggagattcctcgagactcgctgagactggatgtcaagctgggccagggctgcttcggg
gaggtctggatgggcacctggaacgggacgacacgtgtggccatcaagactctgaagcct
ggcaccatgtctcccgaagcgttcctgcaggaggcgcaagtgatgaagaagctccggcat
gagaagctggtgcagctttacgccgtcgtctcagaggagcccatttacatcgtcactgag
tacatgggtcaaggaagcctgctggatttcctgaaaggtgacatggggaaaatgctgcgt
ttgcctcagctcgtggacatggcctctcagatcgcctcaggaatggcatacgtggagaga
atgaactatgtgcacagggacctcagggctgccaacatcctggtgggcgataacctggtg
tgtaaagtggctgatttcggcctcgctcgactcattgaggacaacgaatacactgcgaga
caaggagcaaagtttcctattaagtggactgcaccggaggcggctctgtatggacgcttc
acgatcaaatctgacgtgtggtcgtttgggattttactgacggagctcaccaccaaaggc
agggtgccttatccaggtatggtgaaccgcgaggtgcttgaccaggtggagcgtggctac
aggatgccctgcccagccgagtgccccgactccctgcatgagctcatgctgacctgctgg
cgcaaagagcccgaagagcggcccacattcgagtacctgcagggtttcctggaggactac
ttcacctccaccgaaccacaataccaacccggagaaaacctctag

DBGET integrated database retrieval system