KEGG   Danio rerio (zebrafish): 327197
Entry
327197            CDS       T01004                                 

Gene name
vcp
Definition
(RefSeq) transitional endoplasmic reticulum ATPase
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    327197 (vcp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    327197 (vcp)
   04131 Membrane trafficking [BR:dre04131]
    327197 (vcp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    327197 (vcp)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     327197 (vcp)
Membrane trafficking [BR:dre04131]
 SNARE
  SNARE associated proteins
   Others
    327197 (vcp)
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    327197 (vcp)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   327197 (vcp)
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 CDC48_2 AAA_33 AAA_2 AAA_5 AAA_22 Vps4_C TIP49 AAA_18 RNA_helicase AAA_14 Mg_chelatase IstB_IS21 AAA_28 Parvo_NS1 AAA_7 ATPase ATPase_2 ABC_tran Bac_DnaA DUF815 AAA_17 AAA_24 TsaE Viral_helicase1 Sigma54_activat NACHT Zeta_toxin NB-ARC DUF2075 ResIII bpMoxR UFD1
Other DBs
NCBI-GeneID: 327197
NCBI-ProteinID: NP_958889
ZFIN: ZDB-GENE-030131-5408
Ensembl: ENSDARG00000020008
Vega: OTTDARG00000018539
UniProt: Q7ZU99
Position
5
AA seq 806 aa
MASGGESKNDDLSTAILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLK
GKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIG
GLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRV
INQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKAN
LRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAM
EVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSSNQGG
SGPSQGSSGGGGGNVFNEDNDDDLYG
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcttcgggtggagaatccaaaaacgatgatctttccactgccattctgaagcagaag
aacaggccaaataggttgattgttgatgaatctatcaatgaagacaacagtgttgtgtct
ctctctcaggcgaagatggatgagctgcagctctttaggggtgacacagtgctgctgaag
ggtaagaagagaagggagactgtttgcatcgtcctgtctgatgacacctgctctgatgag
aaggttcgcatgaacagggtggtccgaaacaacctcagggtgcgccttggcgacgtaatc
agtattcagccttgtccagatgtgaagtatggaaaacgcatacatgttctgccaattgat
gataccgtggagggcatcactggcaacctgtttgaggtctatctcaagccttacttcctg
gaggcttacaggccaatccgtaaaggtgatattttccttgtcagaggaggcatgcgtgct
gtggagttcaaagtggtggagactgaccccagcccctactgtattgtggccccagacaca
gtgattcactgtgaaggagaacccatcaagcgagaggatgaggaagagtctctgaatgag
gtgggttatgatgacattggaggggtgagaaaacagcttgcccaaatcaaagaaatggtg
gagcttcctctgagacacccagctctcttcaaggctattggtgtgaagcctccccgtggc
atcctgctgtacggacctcctggaactggaaagacccttattgctcgtgctgtggcaaat
gaaactggagcgttcttcttcctcatcaatggccctgagatcatgagtaaactggcaggt
gaatctgagagtaatttgcgcaaagcttttgaggaagcagagaagaacgcaccagccatc
atctttattgatgaactcgatgctattgcacccaaacgagagaagactcacggtgaggtg
gagaggcgcattgtgtctcagctgctcactctgatggacggactcaagcaaagggctcat
gttatcgttatggcggctaccaacagacctaacagcattgacccagctctcaggcgattt
gggcgctttgacagagaggtggacatcggcattccagatgcaactggaagacttgagata
cttcagatccacactaaaaacatgaagcttgctgatgatgttgatctggagcaggtggct
aatgagacccatggtcatgttggtgctgatctggctgccctttgctcagaggctgccttg
caagccattcgtaagaaaatggacctcattgatttggaggacgagaccattgacgcagag
gttatgaactccttggctgtaacaatggatgactttaggtgggctcttagccagagcaac
ccatctgccctcagagagactgttgtggaggtgcctaacatcacctgggaggatatcggt
ggccttgatgacgtcaagagagagctgcaggagctggtgcagtacccagtggagcatcca
gacaaattcctcaagtttggcatgactccatccaagggtgtgctgttctatggaccacca
ggttgtggtaaaacccttctggccaaggccatcgccaatgagtgccaggccaacttcatc
tcaatcaagggcccagaactgctcactatgtggtttggagaatcagaggcgaatgtccgt
gaaatctttgacaaggctcgtcaggctgctccttgtgtgctcttctttgatgaattggac
tccattgctaaggctcgtggtggaaatgttggtgatggtggcggcgcagctgacagagtc
attaaccagatcctcacagaaatggatggaatgtccagcaagaagaacgtcttcatcatt
ggggccaccaacagaccagacatcattgaccctgccatcctcaggcccggacgtttggac
caactcatctacatcccactgcccgacgagaagtctcgcattgccattcttaaagctaac
ctcaggaagtctccaatctcaaaggatgtggacctggacttcttggccaagatgaccaat
ggcttttcaggtgctgacttgactgagatctgccagagagcctgtaaactggccatccgc
gagtccattgagaatgagatcagacgggaacgtgagaggcagaccaatccttctgcaatg
gaggtggaagaggatgacccagtgcctgagatcaggaaggaccatttcgaggaggccatg
cgctttgcccgccgctccgtcagcgataatgacatccgcaaatatgagatgttcgcacag
accctgcaacagagcagaggctttggcagtttcagattcccatccagtaaccaaggagga
agtggaccaagtcagggctcttctggtggtggaggcggcaacgtcttcaatgaggacaac
gatgatgatctttacggataa

DBGET integrated database retrieval system