KEGG   Danio rerio (zebrafish): 327277
Entry
327277            CDS       T01004                                 

Gene name
sec22bb
Definition
(RefSeq) vesicle-trafficking protein SEC22b-B isoform 2 precursor
  KO
K08517  vesicle transport protein SEC22
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04130  SNARE interactions in vesicular transport
dre04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    327277 (sec22bb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    327277 (sec22bb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    327277 (sec22bb)
Membrane trafficking [BR:dre04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    327277 (sec22bb)
SSDB
Motif
Pfam: Longin Synaptobrevin DUF3958 DUF2924
Other DBs
NCBI-GeneID: 327277
NCBI-ProteinID: NP_958459
ZFIN: ZDB-GENE-030131-5488
Ensembl: ENSDARG00000100435
Vega: OTTDARG00000042728
UniProt: Q7SXP0
Position
8
AA seq 215 aa
MVLLTMIARLADGLPLAASMQEDEQMGRDLQQYQSQAKQLFRKLNEQSPNRCTLEAGSMS
FHYVIEKGVCYLVLCEAGFPKKLAFAYLEDLQAEFHEQHGKKVPTVSRPYSFIEFDTYIQ
KTKKSYIDSRARRNLSNINTELQDVQRIMVANIEEVLQRGEALSALDSKASNLSSLSKKY
RSDAKYLNTRSTYAKLAAGGVFFIMLIVYIRFWWL
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtgctgttgacgatgatcgcgcggctggcggacggactcccgcttgcggcttcaatg
caggaggacgagcagatgggtcgagatctgcagcaatatcagagccaggccaaacagctc
ttccgaaaactaaatgaacagagtcccaaccgatgcaccttagaggcaggatctatgtcc
tttcactatgtcatagagaagggcgtttgctatttggttctctgtgaggccgggtttcct
aaaaagctagcgtttgcttatctggaagatctacaggccgaatttcatgaacagcacggc
aaaaaggtgcccacagtctccaggccttactccttcatagagtttgatacatacattcag
aaaaccaaaaagtcctacattgacagcagagcacgcaggaacctgagcaacattaacaca
gagctacaggatgtacagaggatcatggtggccaatattgaagaagtcctgcagcgggga
gaggctttatctgctttggactcgaaggccagcaacttgtccagcctgtccaagaaatac
agaagcgacgctaagtacctgaacactcgctccacatatgctaagctagcagccggcgga
gtcttcttcatcatgctgatcgtttacatccgtttctggtggctgtga

DBGET integrated database retrieval system