KEGG   Danio rerio (zebrafish): 327321Help
Entry
327321            CDS       T01004                                 

Gene name
mapkapk2a
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    327321 (mapkapk2a)
   04370 VEGF signaling pathway
    327321 (mapkapk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    327321 (mapkapk2a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    327321 (mapkapk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    327321 (mapkapk2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     327321 (mapkapk2a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   327321 (mapkapk2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 327321
NCBI-ProteinID: NP_958460
ZFIN: ZDB-GENE-030131-5532
Ensembl: ENSDARG00000002552
Vega: OTTDARG00000034918
UniProt: Q7T2F2
Position
11
AA seq 382 aa AA seqDB search
MLTNANSPPKFPNQQQQQQQQNPPQFMLGKGSLQIKKNAITDDYKITNQVLGLGINGRVL
EIFYKRSGEKLALKMLHDCPKARREVELHWRASSCTHIVKIVDVYENLYQNRKCLLIVME
CMDGGELFSRIQDRGDQAFTEREASDIMKSIGEAIQYLHAINIAHRDVKPENLLYTSKRP
NALLKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCG
YPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEAKQLIRTLLKTEPTQRMTITEF
MNHPWINQSMEVPQTPLHTSRVLKEEKDTWEDVKEEMTSALATMRVDYEQIKIKRIEDST
NPLLIKRRKKTTVAPENETPAC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttgactaacgccaacagtccgccgaagtttccaaaccaacagcagcaacaacaacag
caaaatccacctcagttcatgctgggaaaaggatcgcttcaaatcaagaaaaatgccatt
accgacgactacaagatcactaaccaggtgctgggactgggcatcaatggcagagtgctg
gagatcttttacaagaggagtggggagaagctcgctttaaagatgcttcatgactgccca
aaagctagacgagaggtggaactgcactggcgggcctcgtcctgtacccatatcgtcaaa
attgttgacgtctatgaaaatctctaccaaaacaggaagtgccttcttattgtaatggag
tgtatggacggaggtgagctcttcagtcggatccaggatagaggggaccaggcattcact
gagagagaggcttctgatattatgaagagcataggagaggccattcagtatttacatgcg
ataaacatcgcacacagagacgttaagccagagaaccttttatatacctctaaaaggcca
aacgcccttctcaaactgacagacttcggatttgcaaaggagaccaccacacacaactct
ctggccaccccctgctatactccttattatgttgccccagaggtgcttggtccagaaaag
tatgacaagtcctgtgacatgtggtctttgggtgtcatcatgtatattctactctgcggt
taccctcctttctattcgaatcatggattggcaatatctcctggtatgaagaaacgaatc
cgaatgggacagtatgagtttccaaatcctgagtggtcggaagtgtcagaggaagccaag
cagcttatcagaacattactgaaaacggagccaacacagaggatgaccataacagagttt
atgaaccacccttggatcaatcaatcaatggaggttccacagacacccctacacaccagc
cgtgttttgaaagaagagaaagacacatgggaagatgtcaaggaggaaatgactagtgcc
ttggcaacaatgagagtcgactatgagcaaatcaaaatcaagaggattgaagactcgacc
aatccgctgctgataaagaggagaaagaaaaccaccgtagctcctgaaaacgagactcct
gcttgttaa

DBGET integrated database retrieval system