KEGG   Danio rerio (zebrafish): 327438
Entry
327438            CDS       T01004                                 

Gene name
si:ch1073-224n8.1
Definition
(RefSeq) B-cell CLL/lymphoma 6 member B protein
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2HE zf-met Zn-ribbon_8 COMM_domain HIP1_clath_bdg zf-LYAR zf-C2H2_11 Macoilin Rad50_zn_hook DivIVA
Other DBs
NCBI-GeneID: 327438
NCBI-ProteinID: XP_001921563
ZFIN: ZDB-GENE-030131-5649
Ensembl: ENSDARG00000104485
Vega: OTTDARG00000042310
UniProt: A0A0R4IX00
Position
5
AA seq 573 aa
MNSKRNNSESGAGRINPGSVSASANSSASASSSHRKQTIINSSHKGEKEECMQNAARDKN
LSISTLRTRLGPTIRSTLSAAVDTLLGEIVTVLSETQRELQTKEQENEKLKVRLEVSERE
LKTLQECLCSAQKLIDQLQGPFGNPPMTGHQVYSTAGHLNSSRLTHRNAPEPDPRCFTGA
EPELSGALGDAIHGFDSREEFKSCHLSIQADGTVTNSFYDPISVHSSNICSDMNRPGEMV
DDSRRLSHTRPQNPPSHPSFSIKEEQVPGSGQLCVQGRDPPTESEHSAQSVCDLAYVHVV
EEERGSRSHHHPSKPTPPPPSRPQNGPSSSLTDPSSPTQGTSGLRSSAQRDSPGLGMSTR
RSPGVGGSSPEEPIRRSISELMGEAPGERPHLCLECGKTFRLISSLKKHLRIHTGEKPYP
CTVCGRRFRESGALKTHLRIHTGEKPYSCSDCGTQFRHLDGLRKHRRTHTGEKPYVCSIC
GKRLSRLQHLKHHQRIHTGERPCCCPLCHRGFKDPASLRKHLRAHQGEPGADEALGMAGL
AEGDGGSMDDEDMRFGMWGEEEGNDGEPVVDCV
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgaactcaaagcgcaacaacagcgaaagcggagcgggtagaatcaacccaggctccgtt
tcagcatcagcaaacagcagcgcatccgcgagctcctctcaccgaaaacaaactatcatc
aactcgtcccacaaaggagagaaggaggagtgcatgcagaacgcggcccgcgacaaaaat
ctgtccatctccacactccgaacccgcctcggaccgaccattcggtccactctgtctgcg
gcggtggacactcttctgggcgagatcgtgacggtgctgtccgagacccagcgcgagctc
cagaccaaagagcaagagaacgagaagctgaaggtccggctcgaggtgtccgagagagag
ctcaagacgctacaggagtgcctgtgtagcgcgcagaaattaatcgaccagcttcagggt
ccctttggaaacccgcccatgacgggacatcaggtgtactccactgctggacacttgaat
tcgagccgcctgactcaccggaacgcacctgagccggacccgcgctgctttactggagct
gaacccgagctgagtggcgctctgggcgatgccatacacggctttgactccagggaggaa
ttcaagagctgccacctctccattcaggccgacgggacggtgaccaacagcttctatgac
ccgatatctgtgcattcatctaatatctgctcagacatgaaccgacctggtgagatggtg
gacgatagcagaagactctcacacaccagaccccaaaaccctccctcacaccccagcttc
tccatcaaagaggagcaggttcccggctctggacagctgtgtgttcagggccgagatcca
cccacagaatccgagcattcagcacagagtgtgtgtgatctggcatatgtccacgtggtg
gaggaagaaagaggctcccgttcgcaccatcatccctccaaacccacccccccacctcca
tccaggcctcagaacggaccctcatcttctctcacagaccctagttcacctacgcagggc
acgtctggccttagatcctcagcccagagagattctcctggtttgggtatgagcactagg
aggagcccaggggttggcggttcatctccggaagagcccatccggcgttccatctccgag
ctgatgggggaggcccccggggaacgtcctcatttatgtctagagtgcggaaagactttc
cgtcttatttccagcctgaagaagcatctaaggatccacacaggagagaaaccgtatccg
tgcactgtatgcggccggcgtttccgtgaatccggcgctcttaagactcacctccgcatc
cacaccggcgaaaagccatattcttgctctgattgcggcacgcagtttcggcatctggat
gggctgcggaagcatcgccgcacacacactggtgaaaagccctacgtgtgcagcatctgc
gggaaacgtctcagccgccttcagcatttgaagcaccaccagcgcattcacacaggagag
cggccgtgctgctgcccactatgccaccgaggatttaaagatccagccagtctgaggaag
cacctccgtgcccatcagggggagccaggggctgatgaagccttagggatggctggtttg
gcagaaggcgatggaggatctatggatgatgaggatatgaggttcgggatgtggggggaa
gaggaagggaatgacggcgagcctgtggtggactgtgtgtag

DBGET integrated database retrieval system