KEGG   Danio rerio (zebrafish): 327556Help
Entry
327556            CDS       T01004                                 

Gene name
porb
Definition
(RefSeq) P450 (cytochrome) oxidoreductase b
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    327556 (porb)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     327556 (porb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 327556
NCBI-ProteinID: NP_001307368
ZFIN: ZDB-GENE-030131-5767
Ensembl: ENSDARG00000059035
Vega: OTTDARG00000035868
UniProt: F8W4Z6
Position
15
AA seq 671 aa AA seqDB search
MADTQPTEMMEEDEPFFSNLDLFLFSLIAGLLIYWLIFRKKAEPIPEFKKLETAAPTTRD
TSFIDKMKKTGKNIVVFYGSQTGTAEEFSNRLAKDAHRYGMKGMAADPEEYDLSELSRMG
EIDNSLAIFCLATYGEGDPTDNAQDFYDWLQEADADFSGLKYTVFALGNKTYEHYNAMGK
YVDKRLEELGAQRIFDLGMGDDDGNLEEDFVSWREQFWPAVCEHFGVEATGEESSIRQYE
LKVHTDLNMNKVYTGELGRLKSFENQKPPFDSKNPFLAPVTVNRKLNKGGERHLMHLELD
ITGSKIRYESGDHVAVYPINDTAMVNKIGELLAVDLDTVISLNNLDEESNKKHPFPCPTT
YRTALTHYLDITNSPRTNVLYELAQYASDPKDQENMRKMASSSAEGKAQYQSWVLDSCRN
IVAILEDLPSLRPPIDHLCELLPRLQARYYSISSSSKVHPNSIHICAVVVEYQTKTGRVN
KGVATNWLKNKMPTDNGHKATVPMYIRKSQFRLPFKSTNPIIMIGPGTGIAPFIGFIQER
GWLKEQGKEVGETVLYFGCRHKNEDFLYQEELAQFEKTGVLTTLNVAFSRDQAEKVYVQH
HLKNNKEAVWKLVHTDNAHIYICGDARNMARDVQTAFYEIAEELGGMSRPQAVDYIKKLM
TKGRYSQDVWS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacacagcccacagagatgatggaggaggacgagcccttcttcagtaacttg
gaccttttcctcttctctctcattgctggcctgctgatctattggctgatcttccgcaaa
aaagctgaacccattccagagtttaagaagctggagaccgcggctccgaccactagggac
accagttttattgacaagatgaagaaaacgggtaagaatatcgtggtgttttacggctct
cagaccggcacagcggaagagttttccaacagactcgctaaagatgctcatcgctacggc
atgaaggggatggcagcagacccggaagaatatgatttgagtgagctttctcgtatgggg
gagatcgacaactctttggcgatcttctgcttggccacctatggagagggcgaccccacc
gataatgcccaagacttctatgattggctacaggaggctgatgctgattttagcggactt
aaatatacagtgtttgcactgggcaataagacatacgagcactacaacgccatggggaaa
tatgtggacaagagactggaggagctgggggcgcagagaatctttgacctgggaatggga
gacgacgatggaaatctggaggaggactttgtgtcttggagggagcagttctggccggct
gtttgcgaacattttggcgttgaggcgaccggtgaagagtccagcatccgtcagtatgag
ctgaaggtacacactgatctgaacatgaataaagtctacactggagagctgggacgactc
aagagctttgagaaccagaaaccacccttcgattcgaagaaccctttcctggcaccagtt
actgtgaaccgcaaactcaataaaggcggcgagagacatctgatgcacctggagctggac
atcacaggctccaaaatcagatacgaatcaggagaccatgtcgcagtgtaccccatcaac
gacacagcaatggtgaacaagatcggggagctgcttgctgtggatctggacactgtgatc
tccctcaacaacctcgacgaggagtccaataagaagcatccgttcccctgcccgaccaca
tatcgtacagctctgactcattatctggacatcacaaactctccacgcacaaatgtactt
tatgaactggcacaatacgccagcgaccccaaagatcaggagaacatgaggaaaatggcc
tcctcttcagctgagggcaaagcacagtaccagagctgggtgctggactcctgcaggaat
attgtggctattcttgaggatttgccgtctttacggccaccgattgaccacctctgtgag
cttctgccacggctgcaggcccgctactactccatttcatcatcttcaaaggttcacccc
aacagcatccacatctgtgctgtagtggtggagtaccagaccaagactggccgggttaat
aaaggagtcgccacaaactggctgaagaacaaaatgcccaccgacaacggacacaaagct
acggtgcccatgtacatccgcaaatctcagttccgacttcccttcaagtccacaaaccca
attataatgattggacctggcacgggtattgcacccttcatagggttcattcaggagcgc
gggtggctcaaagaacaaggaaaggaagtgggagagactgtgttatactttggctgtcgt
cacaagaacgaggactttctgtatcaagaggaacttgcgcagtttgaaaagactggagtt
ctgacaacactcaatgtagctttttccagagaccaggcagagaaggtctatgtgcagcat
cacctgaagaacaacaaggaggcagtttggaagctggttcacacagacaatgcccacatc
tacatctgtggagatgctcgtaacatggctcgcgatgtgcagaccgccttctacgagatt
gcagaggagctgggcgggatgagccggcctcaagctgtagactacatcaagaaactgatg
actaaaggacgctactcgcaggacgtctggagttaa

DBGET integrated database retrieval system