KEGG   Danio rerio (zebrafish): 334017
Entry
334017            CDS       T01004                                 
Symbol
pla1a
Name
(RefSeq) phospholipase A1 member A precursor
  KO
K13618  phosphatidylserine sn-1 acylhydrolase [EC:3.1.1.111]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    334017 (pla1a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.111  phosphatidylserine sn-1 acylhydrolase
     334017 (pla1a)
SSDB
Motif
Pfam: Lipase
Other DBs
NCBI-GeneID: 334017
NCBI-ProteinID: NP_996939
ZFIN: ZDB-GENE-030131-5949
Ensembl: ENSDARG00000102176
UniProt: Q6NYZ4
Position
9:21214940..21226132
AA seq 456 aa
MAWKWIKAFVYLSVCVTSALGDDEEASASKCADFNNTTWLEYRQATKLQVQYLLLTRKNA
NCASLFTQDCLNHTQKHTAYFNSSLPTKVIVHGYRALGSKPSWVSGLAQALLREEDVNVL
VVDWVYGASFAYNLVVENYKEVAVQISVLINQLTKYGSTLESFHFIGVSLGAHVSGFVGT
LFHGKLGRITGLDPAGPMFKSADPFDRLDSSDALFVEAIHTDSDYFGISIPVGHVDFFLN
GGMDQAGCARSRFASMYGYVICDHMRALHVYMSALNGSCPLIGFPCSGYEEFLAGKCITC
DDPFNGTCPQIGLLKNSGITATPLPNQEKVYLLTTASGPFCAHHILVELNVSRLDKTAEV
QLILKSIGHPETELNLKLYTDETRYKTVAAHPEQLCKIDSMQLINTGGRFYRQGDIHFEY
ICISEIPQTRGMDPLCVKNIHIGRGVPWSHDFVQVC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcttggaaatggatcaaggcatttgtttatttgtcggtgtgtgtcacttcagctctg
ggtgatgatgaggaagcgtctgcaagcaagtgtgcagacttcaacaacaccacctggctg
gaatacagacaggccaccaagcttcaggtccagtaccttctgttgacccgaaagaatgcc
aactgtgccagtctgttcacacaagactgccttaaccacacccagaaacacactgcttac
ttcaactcgtcactgcccaccaaagtcattgttcatggatacagggctctaggcagtaaa
ccgtcctgggtgagtggtttagctcaggctctactgagagaagaggatgtgaatgttctg
gtggtggactgggtctatggagcctcctttgcttataacttggtggtggagaactacaag
gaagttgcagttcagatatcggtgcttattaatcagcttacgaaatatggaagcacgctg
gaatcatttcactttattggtgtgagtcttggagcacacgtgtctggattcgtggggacc
ttatttcatggcaagctgggtcgaatcacaggtttggatccagcaggcccgatgtttaag
agtgctgatccgtttgaccgtttggattcatctgatgccttatttgttgaggccattcac
actgattctgactattttgggatatccattcctgttgggcatgtggacttcttcttaaat
ggaggaatggatcaagctggatgtgctcgctcaaggtttgcatcaatgtatgggtatgtc
atttgtgaccacatgagggctctgcacgtctacatgagtgccctgaacggctcctgtcca
ctcattggttttccctgctccggttatgaggagtttctggcaggaaaatgcatcacctgt
gacgaccccttcaatggcacgtgcccacagataggcttgttgaagaacagtgggataaca
gcgactcccctgccaaatcaagagaaggtttatctgctgaccactgcttcaggtccattc
tgtgcacatcacatccttgtggagttaaacgtttcccgtttagacaaaactgcagaggtt
cagctcattctgaaatccattggacatcctgagacggagctcaatctcaaactatataca
gacgaaacaaggtataaaacggtggctgcacaccctgagcagctgtgtaaaattgactca
atgcagctgataaacactggaggtcgattctacagacaaggagacattcattttgagtat
atttgcatctctgaaatccctcaaaccagagggatggatccactatgtgtaaagaacatt
catattggacgtggagtaccatggtcacatgactttgtacaggtgtgctaa

DBGET integrated database retrieval system