KEGG   Danio rerio (zebrafish): 334130Help
Entry
334130            CDS       T01004                                 

Gene name
lrrc40
Definition
(RefSeq) leucine-rich repeat-containing protein 40
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 334130
NCBI-ProteinID: NP_956156
ZFIN: ZDB-GENE-030131-6062
Ensembl: ENSDARG00000017708
Vega: OTTDARG00000019772
UniProt: Q7SXW3
Position
6
AA seq 601 aa AA seqDB search
MSRFKRGAHVDSRAGFRQEKEDCPVPYGLLKAARKSGQLNLSGRGLTEVPASVWRLNLDT
PQEAKQNVSFGAEDRWWEQTDLTKLLLSSNKLQSIPDDVKLLPALVVLDIHDNQLSSLPD
SIGDLEQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDDLDLS
NNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPPVLAQM
ESLEQLYLRHNKLRYLPELPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVK
SLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGEL
LKYLRSRVQEPPNGGLKEEPKTAMTFQSQAKINIHAIKTLKTLDYSEKQDASIPDDVLDA
VDGNPVANVNFSKNQLTAVPHRIVDLKDTLADINLGFNKLTTIPADFCHLKQLMHIDLRN
NLLISLPMELEGLIKLRSVILSFNRFKSFPEVLYRIPSLETILISSNQVGGIDAVQMKTL
SRLSTLDLSNNDIMQVPPELGNCTSLRALMLDGNPFRNPRAAILIKGTDAVLEYLRSRIP
T
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttttaaaagaggagcacacgtggactccagagcaggattcagacaagagaag
gaagactgtcctgttccgtatggcttactgaaagctgctagaaagagcgggcagctcaat
ctgtccgggcgcggtctaaccgaagttcctgctagtgtatggaggttgaacttagacaca
cctcaggaagccaagcaaaatgtgtcttttggagctgaagatcggtggtgggaacagact
gatctgaccaaactgcttctgtcctccaacaaactccagagcatccctgatgatgttaaa
cttctgcctgccctggtggtccttgatatccatgacaatcagcttagctcgctgccagat
tctattggagatctagagcagctacagaagctgatattgagtcacaataaactgacagaa
ttgccttcgggtgtctggagactcacaaacctgcgatgtctccatctgcaacagaatctc
attgaacagattcctcgagatctagggcagctggttaacttggatgaccttgatctttcc
aacaatcatctaatagatattccagaaagccttgcaaacctccaaaatcttgtgaagttg
gatttgtcctgcaacaagctcaagagtcttcctcctgccatcagtcaaatgaaaaacctg
agaatgctggactgttcccgaaaccagatggagagcattcctcctgtcctggctcagatg
gagtcccttgaacagctttacttgagacacaacaagctacgctatttgcctgaactgccc
tgctgtaaaacactgaaggaacttcattgtggaaataaccagattgaggtattggaggca
gagcatctgaagcacctgaacgctctgagtttgctggagctcagagataataaggtgaag
agccttcctgaggaaataaccctactgcaaggcctggagcgcctggatcttactaacaat
gacatcagcagtctgccgtgtggacttggcacattacccaaactgaagtctttgtccttg
gaaggcaacccactgagggcaatccgcagagatctcctgactaaaggcactggtgaactc
ctaaaatatctcagaagtcgtgtacaagagccacctaatggaggcttgaaagaagagcca
aaaacagcaatgactttccaaagtcaagctaaaattaatatacatgccattaaaacgctg
aaaacactggactacagtgaaaaacaagacgcatcgattccggatgatgtgttggacgca
gttgatggtaatcctgtggccaatgtgaactttagcaaaaatcagctgacggctgttcca
cacagaattgtggatttaaaggacactctggcagacattaatcttgggtttaacaagcta
acgaccattccggcggacttttgtcatttgaaacagctgatgcatatagatctcaggaac
aatctactgatctcactgccaatggagctggaaggcttaatcaaactgcggagtgttatt
ttgtcttttaataggtttaagtcattcccagaagtgctgtaccgaatcccatccctagaa
accattttaatcagcagcaatcaagttggaggcattgatgctgtccaaatgaagacctta
agtaggctgtcaaccctggatctgtccaacaatgacatcatgcaagtgccaccagaactc
ggcaactgtaccagtctgagggctctaatgcttgatgggaatcctttccgtaatccaaga
gctgccatccttattaaaggcacagatgctgtccttgagtatctccgaagtcgtattcca
acatga

DBGET integrated database retrieval system