KEGG   Danio rerio (zebrafish): 334488
Entry
334488            CDS       T01004                                 

Gene name
xrcc6
Definition
(RefSeq) X-ray repair cross-complementing protein 6
  KO
K10884  ATP-dependent DNA helicase 2 subunit 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    334488 (xrcc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    334488 (xrcc6)
   03400 DNA repair and recombination proteins [BR:dre03400]
    334488 (xrcc6)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    334488 (xrcc6)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     334488 (xrcc6)
SSDB
Motif
Pfam: Ku Ku_N Ku_C SAP VWA SAP_new25 Rho_N DUF4225 VWA_2
Other DBs
NCBI-GeneID: 334488
NCBI-ProteinID: NP_956198
ZFIN: ZDB-GENE-030131-6420
Ensembl: ENSDARG00000071551
Vega: OTTDARG00000036561
UniProt: F1QZ60
Position
12
AA seq 610 aa
MANWGNYFPNEDDVDEQDEEESGGDYKSSGRDSLVFLVDASKEMFIKGENGEPSNFDMTM
QCVRSVYTSKIISSDRDLVALVFYGTEQSKNPRNSFKHVYVYHDLESPGAKRVQDIDKLK
GDKGGQFAEKTMGSGETSLGEALWCCSNLYSDIKLRLSHKRLMIFTCRDEPHGGDSAKDR
QARTKAADLKETGVAIDLMHLSKPGGFDVSLFFCDIVSPPEDESDLGLQIEPCRKLEDLQ
KRVRAKELKKRAQCRLTFSLGEGVDLAVGVYVLARTAMKPSAVKLYRDNNEPVRTKSRLF
HTQTGGILLPNDTKRAQVYGQKQIVMEKDEVDEIKKFDDPGLVLIGFKPIDRLKLHHHLR
PALFIYPEEEQISGSSCMFTALLLKCCEKNVFALCKYIPRRNTPPRFVALVPQREELDQS
QTQATPPGFHVIYLPFADDIRTVDPHVGPTASDEQVDKMKEIVHKLRFKYRSDAFENPVL
QQHYSNLEALALDMLSPEPIEDLTMPKVKMMDDRLGPLVQEFKDLVYPPDYNPEGKPAAK
RKPAESGGGAAEKKAKVEISEEELKIHVAKGTLGKLTVPVLKDACKQFNIRTTGTKKQEL
IDALTMQLSK
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggcgaactggggaaattactttccaaacgaagacgatgtggatgagcaggatgaagaa
gagtctggaggcgattacaaaagcagcggccgtgacagcttggtgtttttggttgatgca
tccaaagagatgttcatcaaaggggagaatggagagccatcaaattttgacatgactatg
cagtgtgtgcgcagtgtgtacactagtaagatcataagcagtgacagagacctggttgct
ttggtgttttatgggactgagcagagcaagaaccccagaaactccttcaagcatgtttac
gtctaccacgacttggagtcccctggagcaaaacgtgtacaggatattgataaactgaaa
ggtgataaaggtggtcagtttgctgaaaagaccatgggcagtggggaaacttctctcgga
gaggctctgtggtgctgttccaacctttacagtgacatcaagttgcgactgtcacacaag
cgcctcatgatattcacatgcagggatgagcctcatggaggagacagtgcaaaagacaga
caggctcgtacaaaggctgctgacctaaaagagacaggtgtagccattgacttgatgcac
ctctcaaagcctggagggtttgatgtttcactgttcttttgcgatattgtaagtcctcca
gaagatgaaagtgatctcggccttcagattgagccctgcaggaaactggaggacctgcag
aagagagtcagagcaaaagagttaaagaaaagagctcaatgcaggttaacgttctccctt
ggagaaggtgtcgatctggctgttggcgtatacgtgttggccaggactgctatgaagcct
tctgctgtcaaactttacagagataataatgaacctgtacggactaaatcccgtctcttc
cacactcaaactggtggcattttattaccaaatgatacaaagagggcacaggtttatggg
cagaagcagattgtgatggaaaaggatgaggtggatgagataaagaagtttgatgatcca
ggattggtactgattggatttaagcctatagatcgcctcaaactgcaccatcatttacga
cctgctcttttcatataccctgaggaggagcagatatcaggaagctcctgtatgtttaca
gctctgcttttgaagtgctgtgaaaaaaatgtatttgcattgtgcaaatacatccctcgt
cgtaacactccacctcggtttgtggcactagtgccccagagagaagaactggatcagagt
caaacccaggcaacacctccaggcttccatgtgatttatcttccctttgctgatgacata
cgcactgtggaccctcacgttggtcccacagcctcggatgagcaggtagacaaaatgaaa
gagatcgtgcacaagctccgctttaaatacaggagtgatgcatttgaaaacccagtgctg
caacagcactacagtaatctggaggctttggctctggatatgctttcacctgaacccatt
gaggatttgacaatgccaaaggtaaaaatgatggacgatcggcttggtccgctggttcaa
gagttcaaagatttggtctatcctcctgattataacccagaagggaaacctgcagctaaa
cgcaaacctgctgaatctggtggtggtgctgctgaaaagaaggccaaagttgagatttcc
gaagaagagctgaaaattcatgtcgcaaaaggcactttgggaaaactgacagtgcctgta
ctaaaagatgcatgcaaacagtttaatatacgtacaacaggaaccaagaaacaggagctt
atcgatgccctgaccatgcagctctctaaatga

DBGET integrated database retrieval system