KEGG   Danio rerio (zebrafish): 334490Help
Entry
334490            CDS       T01004                                 

Gene name
hnrnpub
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U
  KO
K12888  heterogeneous nuclear ribonucleoprotein U
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    334490 (hnrnpub)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    334490 (hnrnpub)
Spliceosome [BR:dre03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    334490 (hnrnpub)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_33 SPRY SAP AAA_17 Viral_helicase1 AAA_18
Motif
Other DBs
NCBI-GeneID: 334490
NCBI-ProteinID: NP_001028767
ZFIN: ZDB-GENE-030131-6422
Ensembl: ENSDARG00000004735
Vega: OTTDARG00000005736
UniProt: Q5RHQ7 Q1ECZ7
Position
20
AA seq 796 aa AA seqDB search
MSEINVKKLKVNELKDELKKRQLSDKGLKAELMERLQAALDAEAQAQEEETTAPGTTEGS
KVGNDADGNGVAAEQEGTGEEEPEGENMEAEEQNGEGDEAAGQDDEMGEEEEEDDDDDDA
GEEIDKALDDEDDEEDDIIDKIDVEDGDADKDSSADQKNKKGVKRRREDHGRGYFEFIEE
SKYSRTKSPQPPLEEVDEEFDDTLVCLDPYNCDLHFKVSRNRYSASSLTMESFAHLWAGG
RASYGVNKGKVCFEMKVTEKTPIKHLNSKIMDFHDVHIGWSLANGCLSLGEEEFSYSYSD
KGKKASNCVTEDYGEGFDENDVIGCFINFEADEVEISFSKNGNDLGVAFKVNKESLADRA
LFPHVLCHNCTVEFNFGQNETPFFPKLEDFTFMQQIPLEERIRGPKGPVAKKDCEVIVMV
GLPGSGKTTWVVKHVEENPGKYNILSTNTVLEKLMINSVKRQNKDITKLMAISQRVPFYL
GKLIEIAARKKRHYILDQTNVSSAAQRRKMCLFAGFQRKAVVVFPTDENLKERAQKKAEA
DGKDIPEHALLKMKALYTLPEQGDCFSEVTYVELQKDEASKLLEKYKEESKNALPPEKKP
NQGPPTPKRGSRRGRGQKNQFNRSGGGGGGGGQGNRGGRGGFQPRGNYRALLAPPRVSGF
DRRPRGYILPPPPPPPVYRGYPSRDGYNRGGSGGMQSRGMSPRGGQMRGNMASRGGGMSR
GGHANRGGNMHRGGGQGGPNHRGHYQQKFHGRGGHQQNRGGYGNKNSSFAQAFNQSWQQG
FWNQKPWNQQYHPGYY
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatcaacgtgaaaaagcttaaggtgaacgagctgaaggacgagctaaagaag
cggcagctctctgacaaggggttgaaggccgagctcatggagcgtctgcaggccgcgctc
gacgcagaggcccaggcccaagaggaagaaacgaccgcgccagggactacagaaggtagt
aaggtaggaaacgatgccgatggaaacggcgttgcagccgaacaagaaggtacgggtgaa
gaagagccggagggggaaaacatggaggccgaggagcagaatggggaaggagatgaagcc
gccggtcaggacgacgaaatgggagaggaggaggaggaggacgacgacgacgacgacgcc
ggggaggaaatagacaaagccttagacgatgaagatgatgaagaagacgatatcattgac
aaaatcgacgttgaagacggggatgcggacaaagacagcagtgctgatcagaagaataag
aagggtgttaagagacgccgagaggatcatggaaggggctactttgaatttattgaagaa
agcaaatacagccggaccaagtctcctcagccgcctttggaggaagtggatgaagagttt
gatgacaccctggtctgcttggatccatacaattgtgaccttcacttcaaagtgtcccgg
aaccgttacagtgcctcctctcttaccatggagagttttgctcacctttgggcaggtggc
cgtgcatcttatggtgtaaacaagggcaaagtctgctttgaaatgaaggtcactgagaaa
accccaatcaagcatttaaacagcaaaatcatggacttccatgatgtccatattggctgg
tctctggctaatgggtgtctgtcactaggtgaggaggagttttcttactcctattctgac
aaagggaagaaggcttcaaactgtgtgactgaagactacggggagggctttgatgaaaat
gatgtcatcggctgcttcattaatttcgaggctgatgaagtggagatttccttttctaaa
aatggcaatgaccttggtgtggctttcaaggtcaataaggagtcgttggctgacagagcc
ctgttcccccatgttctttgtcacaactgtactgttgagttcaattttggtcagaacgag
actccgttcttccctaagttggaggacttcacctttatgcagcagattcctctggaagag
cgtatcagaggacccaaaggacctgtggccaagaaagactgcgaggtgattgtcatggtc
ggccttcctggatctggaaaaactacctgggtagttaaacatgttgaagaaaaccctggg
aagtacaacatcctcagcaccaacaccgtcttggagaaattgatgattaacagcgtaaag
aggcaaaataaagacataacaaaactcatggccatttcccagcgtgttcctttttacctg
ggcaagttgattgaaattgctgcccgcaaaaaaagacactatattttggaccagacgaac
gtctcttcagcagcccaaagaaggaagatgtgtctgtttgctggtttccagcgcaaagcc
gtggtggtctttcccacagatgagaacttaaaggagagagcgcagaagaaggcagaagcg
gatggtaaagatatacccgagcacgccctactcaaaatgaaagctctctacacgcttcca
gaacaaggggactgcttttcagaggtcacctatgttgagctgcagaaggacgaggcctcc
aagcttttggagaagtacaaggaagagagtaagaatgctttgcctccagagaagaagccc
aaccagggacccccaactcccaaacggggatcccgccgaggaagagggcaaaagaaccag
ttcaacaggagtggtggtggtggtggtggtggtggtcaaggaaaccgtggaggcaggggt
ggattccagccccgaggaaactacagagcgttgcttgcaccacctcgtgtgagcggattt
gatcgtcgcccgcggggttacattctgccacctccaccaccaccaccagtctaccgaggt
tatcctagcagagacggttacaacagaggagggtctggtggaatgcagagtagaggaatg
tctccgcgcggtggacaaatgaggggcaacatggccagcagaggtggtggaatgagccgt
ggaggacatgccaacagaggaggaaacatgcaccgcggaggtggacaaggtggtcccaac
cacagaggacactaccagcagaaattccacggcagaggaggccaccagcagaatcgtgga
ggatatggcaacaagaacagctcttttgcccaagccttcaaccagagctggcaacaaggg
ttctggaaccagaagccatggaatcaacagtaccatccaggatattattga

DBGET integrated database retrieval system