KEGG   Danio rerio (zebrafish): 334619
Entry
334619            CDS       T01004                                 

Gene name
c1qbp
Definition
(RefSeq) complement component 1 Q subcomponent-binding protein, mitochondrial
  KO
K15414  complement component 1 Q subcomponent-binding protein, mitochondrial
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    334619 (c1qbp)
Glycosaminoglycan binding proteins [BR:dre00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   334619 (c1qbp)
SSDB
Motif
Pfam: MAM33 MACPF
Other DBs
NCBI-GeneID: 334619
NCBI-ProteinID: NP_001017858
ZFIN: ZDB-GENE-050417-408
Ensembl: ENSDARG00000039887
Vega: OTTDARG00000033165
UniProt: F1R3F7
Position
5
AA seq 270 aa
MLKSVTRALQLSARLSSRSSANRTAPISRSFWSLRSPGAAAASRPKILTAARALPTLSCG
CGGLHTDGDKAFAEFLTEEIKEEKKIQKSKSLPKMSGGWELELNGTEAKLIRSLSGEKVT
ITFNVNNSIPPQLEEEPEQTQKSQEEEPDIVSTPNFVVEVTKSGAKNSLVFDCHFPEDEV
GHGDGEEESDIFTIREVSFQPEGEEDWKETSYTLNTDSLDWALYDHLMDFLADRGVDNTF
ADELMELSTALEHQEYIKFLEDLGTFVKCK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgctgaagtcagtgactcgcgcgctgcagctctccgcccggctgtccagcaggagctcc
gccaacagaaccgctccaatcagccgctcattctggagcctcaggagccccggagcggcc
gctgcttccaggccgaagatcctcaccgccgcccgggctctgcccacactgagctgcggc
tgcgggggtctccacaccgacggtgataaagccttcgcagagtttctgactgaagaaatc
aaagaagaaaagaagatccagaagagcaaaagtcttcctaaaatgtctggcggatgggag
ctggaactcaacggcactgaagcaaaactcatccgctcgctctcaggagaaaaggtcacc
atcacttttaatgtgaacaacagcatcccaccacagctggaggaagagcccgagcagaca
cagaagagtcaggaggaggagcctgacattgtctcgacacccaactttgtggttgaagtg
accaaatcaggagcaaagaactcgctagtgtttgactgccacttccctgaggacgaggtc
ggtcatggagacggcgaggaggagagcgacatcttcaccatccgggaggtcagtttccag
ccagagggagaagaggactggaaggagaccagttacacactcaacacagactctctggac
tgggccctgtatgaccatctgatggactttctggcggaccgcggtgtcgacaacacgttt
gcagatgagctgatggagctgagcacggcgctggagcatcaggagtacataaagttcctg
gaggatctcggcactttcgtcaaatgcaaataa

DBGET integrated database retrieval system