KEGG   Danio rerio (zebrafish): 335195Help
Entry
335195            CDS       T01004                                 

Gene name
ywhaqb
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04110  Cell cycle
dre04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    335195 (ywhaqb)
   04114 Oocyte meiosis
    335195 (ywhaqb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dre03400]
    335195 (ywhaqb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    335195 (ywhaqb)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    335195 (ywhaqb)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   335195 (ywhaqb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF4518
Motif
Other DBs
NCBI-GeneID: 335195
NCBI-ProteinID: NP_958892
ZFIN: ZDB-GENE-030131-7135
Ensembl: ENSDARG00000023323
Vega: OTTDARG00000020375
UniProt: Q803M8
Position
17
AA seq 245 aa AA seqDB search
MDRTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWR
VISSIEQKTEGNDKKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLK
MKGDYYRYLAEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYE
ILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNAPDEGEGG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacagagctcatccagaaggcgaagctggcagagcaggcagaacgctatgat
gatatggcgtcctgtatgaagtcggtgaccgaagctgggtctgagctgtccaacgaggaa
agaaatctgctgtccgttgcctataagaacgtggtgggtgcccggaggtctgcctggagg
gtcatctccagcattgagcagaagaccgaaggaaacgacaagaaattgcagatggtgaag
gaataccgggagaaagtggagtctgagctgcgagatatctgcaatgatgtgttggagctt
ctgaacaaatatttaattgagaattcctcaaatccagagagcaaagtcttctacctgaag
atgaagggcgactactacagatacctggctgaagtggctgcaggagacgacaagaaagca
accattgagaactctcaggatgcttaccagaaagcgtttgatatcagcaagacagagatg
cagcccacacaccccattcgtctgggtctcgctctcaacttctctgtcttcttctacgag
atcctcaactctccagaaaaggcctgctctcttgctaaacaggcattcgacgaggccata
gcagagctggatactctgaatgaagagtcctataaagacagcactcttatcatgcagcta
ctgagagacaacctcacattatggacatctgacaacgcaccggatgagggagaaggaggc
gagggaggagagaactaa

DBGET integrated database retrieval system