KEGG   Danio rerio (zebrafish): 335250
Entry
335250            CDS       T01004                                 

Gene name
mecp2
Definition
(RefSeq) methyl-CpG-binding protein 2 isoform 2
  KO
K11588  methyl CpG binding protein 2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    335250 (mecp2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    335250 (mecp2)
SSDB
Motif
Pfam: MBD
Other DBs
NCBI-GeneID: 335250
NCBI-ProteinID: NP_001315484
ZFIN: ZDB-GENE-030131-7190
Ensembl: ENSDARG00000014218
Vega: OTTDARG00000020060
UniProt: Q7T2T7 A8WIP2
Position
8
AA seq 523 aa
MAAAESGEERLGEDKNEDQEGSKDKTQKHKKSKKERHDVEKLETTVSVPPPPSLFTQRDV
GQQAEAGKSEPIDPEVGAALSAPESSASAKQRRSVIRDRGPMYEDPSLPQGWTRKLKQRK
SGRSAGKFDVYLINPEGKAFRSKVELMAYFQKVGDTITDPNDFDFTVTGRGSPSRREKRP
PKKPKMVKPSGRGRGRPKGSGKVRQATEGVAVKRVIEKSPGKLLVKMPFVAPKTEPGAPL
GQAPVAKARRGRKRKSEQDPPSTPKKRGRKPATVSQSTVGTGSAAAYAAAAILTAEAKKK
ALKESSAKPVQERALPIKKRKTRETLEELEASTTSATETFEKRLTASTVTPTGEEAETGQ
KPHKHPSRKHKEADPGSSSSGTTASGVAPKSHKKRDQRGQHFKHHHHHHHHHHQHQHLQA
STPSTYTPQAHQLSLGHSTHGGLENEPQDLSTSRPKAEHVACREEARTGSSSSRDSQNAS
KMASMTVTGESKELRDIVPPSAVPRPSREETVESRTPVSEPVS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggccgccgcagagagcggagaggagagactaggtgaggacaagaatgaagaccaggag
ggctcaaaagacaagacgcagaagcataagaaaagcaaaaaggaaaggcatgatgtggaa
aaactggagaccacagtctctgttcctccgcccccgtctctctttacgcagagggatgtc
ggacagcaggcagaggcagggaagtctgaacccattgaccctgaagttggagctgctctc
agcgctccagaatcttccgcatcggccaagcagcggcggtctgtcattcgggacagaggc
ccaatgtatgaagatccttcgctgcctcagggctggacacgcaagctgaaacagcgcaaa
tcagggcgctccgctggcaaatttgacgtctaccttatcaacccagaagggaaagccttc
cgttccaaggtggagctcatggcatacttccaaaaggttggcgataccattacagatccc
aatgactttgacttcacggtcacgggcaggggaagcccgtctcgcagagaaaaaagaccg
ccaaaaaagcctaaaatggtcaaaccctctggacgtggaagggggcggcctaaaggtagc
ggcaaggtacgacaggctacagaaggggtggcggtgaaacgcgtcatagaaaagagtcca
ggaaaactcttagtaaagatgccctttgtggcccccaaaactgaaccaggggctccttta
gggcaagcgccagttgccaaagcacgccgaggacgtaagaggaaatcagagcaggatccg
ccaagcacccctaaaaaacgtggacgcaagccagcaactgtttcacagtcaacagtgggg
acggggtctgctgctgcatacgccgctgcagccattctcaccgccgaagccaagaaaaaa
gccctgaaggagtcttccgctaagcctgttcaggagagggctcttcctatcaaaaaacgc
aaaacccgagagactttagaggagctggaggcatccaccacctcagcgacagagaccttt
gagaaacgactgactgcatcaactgtgacccctaccggggaggaggcagaaacaggacag
aagcctcacaagcatcccagccggaagcacaaagaggcagatccgggaagcagcagcagt
gggacgacagccagcggagttgcaccgaagagtcacaagaagagagatcagcgagggcag
cactttaaacaccaccaccaccatcatcatcaccaccatcaacaccaacacctgcaggcc
tccacaccctccacctacactccgcaggctcaccagctctccctgggtcactccacgcac
ggcgggctggaaaacgagccgcaggacttgagcacctccaggcccaaagcggagcacgtg
gcctgcagggaggaggccagaactggcagctcctcgagtagggactcccagaacgcaagc
aagatggcttccatgaccgtgacgggggaaagcaaggagctgagagacattgttcctccc
tccgccgtcccgaggccgagtcgagaggaaacggtggagtcccggacaccagtgagcgag
ccagtgagctga

DBGET integrated database retrieval system