KEGG   Danio rerio (zebrafish): 336281
Entry
336281            CDS       T01004                                 

Gene name
vamp2
Definition
(RefSeq) vesicle-associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    336281 (vamp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    336281 (vamp2)
Membrane trafficking [BR:dre04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    336281 (vamp2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    336281 (vamp2)
SSDB
Motif
Pfam: Synaptobrevin Orf78 RIFIN MCU Fusion_gly CD34_antigen ODV-E18 DUF2207 PRIMA1
Other DBs
NCBI-GeneID: 336281
NCBI-ProteinID: NP_956299
ZFIN: ZDB-GENE-030131-8225
Ensembl: ENSDARG00000056877
Vega: OTTDARG00000002135
UniProt: Q7SZZ5
Position
10
AA seq 110 aa
MSAPAGAPAPEGGNQAPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDR
ADALQAGASQFETSAAKLKNKYWWKNAKMMIILGVICVIVLIIIIVYFST
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtctgccccagccggagcccctgccccagaaggaggaaaccaagctcctccaaacctc
accagcaatcgtcgcttacagcagacacaggctcaggtggatgaggtcgtggatattatg
cgtgtaaacgtagacaaggttctggaaagggaccagaagctatcagaactggatgatcgg
gctgatgccctgcaggctggagcctcacagttcgagaccagcgccgccaagctcaagaat
aaatactggtggaagaatgccaagatgatgattatcctgggggtgatatgcgtgattgtc
ctcattataatcattgtgtacttcagcacctaa

DBGET integrated database retrieval system