KEGG   Danio rerio (zebrafish): 336334
Entry
336334            CDS       T01004                                 

Gene name
eef1a1a
Definition
(RefSeq) elongation factor 1-alpha 1a
  KO
K03231  elongation factor 1-alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    336334 (eef1a1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    336334 (eef1a1a)
   03016 Transfer RNA biogenesis [BR:dre03016]
    336334 (eef1a1a)
   03012 Translation factors [BR:dre03012]
    336334 (eef1a1a)
   04131 Membrane trafficking [BR:dre04131]
    336334 (eef1a1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    336334 (eef1a1a)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     336334 (eef1a1a)
Transfer RNA biogenesis [BR:dre03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    336334 (eef1a1a)
Translation factors [BR:dre03012]
 Eukaryotic type
  Elongation factors
   336334 (eef1a1a)
Membrane trafficking [BR:dre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    336334 (eef1a1a)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   336334 (eef1a1a)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA
Other DBs
NCBI-GeneID: 336334
NCBI-ProteinID: NP_956303
ZFIN: ZDB-GENE-030131-8278
Ensembl: ENSDARG00000039502
Vega: OTTDARG00000022867
UniProt: Q6P969
Position
13
AA seq 462 aa
MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRKEGNAAGTTLLEALDAIQPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMIPGKPMCVESFSEYPP
LGRFAVRDMRQTVAVGVIKGVEKKTATSGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggagaagctccacatcaatattgtggttattggccatgtggattctggaaag
tccactacgactggtcacctcatctacaaatgcggtgggattgacaaaaggaccattgag
aagtttgagaaagaagctgcagagatgggaaagggttcctttaagtatgcctgggttctg
gacaagcttaaagcagagagagagaggggaatcacaattgacatctccttgtggaagttt
gagaccagcaaatactacgtcaccatcattgatgctccaggacacagagacttcatcaaa
aacatgatcactggaacctcacaggcggattgtgctgtgctgattgtggcggctggtgtt
ggggagtttgaggctggcatctcgaagaacggccagaccagagaacacgctcttctggct
tacacactgggtgtgaagcagctcattgtgggtgtcaacaagatggattccactgaaccc
agttacagccagaagcgttatgaggaaattgtgaaggaagtcagcacatacatcaagaag
attggctacaatcctgacactgtggcatttgtgcccatctctgggtggaatggagacaac
atgcttgaggccagtcccaatatgagttggttcaaaggttggaagataacccgcaaggaa
ggtaacgcagccgggaccaccctattggaggctttggatgccattcagcctccaactcgt
ccaactgacaaacctcttcgcctgcctcttcaggacgtttacaagattggaggcatcgga
accgttcctgtgggccgtgtggagactggccttttgaagccaggtatggtggtcaccttt
gcaccagtcaatgtgacaactgaagtcaagtctgtagagatgcatcatgaggctctttct
gaggcgctgcccggggacaatgttggcttcaatgttaagaatgtgtccgtcaaggacatc
cgtcgtggcaacgttgctggggacagcaaaaatgacccgccgcaagaagctgccaatttc
actgctcaagtgatcatcttgaaccacccagggcagatcagtgctggttatgcccctgtg
ctggattgccacactgcccatattgcctgcaaattcgcagagctgaaagaaaagatcgac
cgtcgttctggaaagaagcttgaagacaaccccaagagcttgaagtctggagacgcggcc
attgtggaaatgatccctggaaagcccatgtgtgtggaaagcttctccgagtatcctcct
ctgggtcgttttgctgtgcgtgacatgcgtcagacggttgcggtgggagtgattaaagga
gtggagaagaagaccgcgacaagcggaaaggttaccaaatctgcccagaaagcccagaag
gccaaatga

DBGET integrated database retrieval system