KEGG   Danio rerio (zebrafish): 336381
Entry
336381            CDS       T01004                                 

Gene name
cotl1
Definition
(RefSeq) coactosin-like protein
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Cofilin_ADF STb_secrete
Other DBs
NCBI-GeneID: 336381
NCBI-ProteinID: NP_956306
ZFIN: ZDB-GENE-030131-8325
Ensembl: ENSDARG00000026829
Vega: OTTDARG00000012469
UniProt: Q6PFT7
Position
18
AA seq 142 aa
MATRIDKEACREAYNLVRDDSSGICWACFKYDGSTIVPGGHGSDYEEFKSQCTVDSRVFG
FVRIMTGDAMSKRSKFTFITWIGENITGLQRAKISTDKALVKDAVPTFAKEFMISDPKEL
EEEYLRTELKKAGGANYDAQAE
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcaacacgaattgacaaagaggcttgcagagaggcatacaatctggtgcgagacgac
agctcaggtatatgctgggcatgttttaagtatgacggatctacaattgtaccaggcggg
catgggtccgactatgaagaattcaagagccagtgtacagtggactcccgtgtgtttggt
tttgtgaggataatgacgggtgacgccatgagcaagcgttctaagttcaccttcatcacc
tggattggtgagaacatcaccggcctgcagagagccaagatcagcaccgacaaggcactg
gtcaaagatgccgtgccgacctttgccaaggagtttatgatcagcgaccccaaagagctg
gaggaagaatacctacgtactgagctcaagaaagctggcggcgccaactatgatgcccag
gctgaataa

DBGET integrated database retrieval system