KEGG   Danio rerio (zebrafish): 336391
Entry
336391            CDS       T01004                                 

Gene name
tmed3
Definition
(RefSeq) transmembrane emp24 domain-containing protein 3 precursor
  KO
K20350  p24 family protein gamma-4
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    336391 (tmed3)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    336391 (tmed3)
SSDB
Motif
Pfam: EMP24_GP25L GOLD_2
Other DBs
NCBI-GeneID: 336391
NCBI-ProteinID: NP_001122140
ZFIN: ZDB-GENE-030131-8335
Ensembl: ENSDARG00000028816
Vega: OTTDARG00000020176
UniProt: B3DKM3
Position
7
AA seq 206 aa
MRHSFLLLAVYIAFVNATELTFELPDNEKQCFYEELEQGVKFDIDFQVIAGGNYDVDCFV
TDPINNMLYQERKKQYDSFSHTTVMKGVYKVCFSNEFSTFSHKTVYLDFRSGEDDRLFPD
QNRATALTQMESACLSIHEILKVVSDSQTWYRLREAQDRLRAEDLHERVHFWSIGETVIL
FVVCIGQVLMLKSFFNEKKTGVSTST
NT seq 621 nt   +upstreamnt  +downstreamnt
atgagacactcctttttacttttggctgtgtacatagcctttgtaaatgccaccgaatta
acttttgagctgcccgataacgaaaagcaatgcttttacgaggaactagagcaaggagtc
aagtttgatatagactttcaggttattgccggaggaaactatgatgtggactgttttgtg
acagatccaataaataacatgctgtatcaggaacgaaaaaagcagtatgacagcttttcc
cacacaacagtcatgaagggagtgtacaaggtctgcttcagcaatgagttctcaaccttc
tctcacaagactgtttacctggacttcagaagcggagaggatgaccggctattccctgac
cagaacagagccacagctctcacacagatggagtcagcctgcctgtctatccatgagatc
ctcaaagtggtttcagactctcagacctggtatcgtcttcgagaggctcaggatcgtctc
agagcagaggacctgcacgagcgtgtgcacttttggtccatcggggagaccgtcatcctg
tttgtagtctgcattggccaggtgcttatgctgaagagtttcttcaatgagaagaaaact
ggtgtgtccaccagcacatag

DBGET integrated database retrieval system