KEGG   Danio rerio (zebrafish): 336471
Entry
336471            CDS       T01004                                 

Gene name
col1a2
Definition
(RefSeq) collagen alpha-2(I) chain precursor
  KO
K06236  collagen type I alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04510  Focal adhesion
dre04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    336471 (col1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    336471 (col1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    336471 (col1a2)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   336471 (col1a2)
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 336471
NCBI-ProteinID: NP_892013
ZFIN: ZDB-GENE-030131-8415
Ensembl: ENSDARG00000020007
Vega: OTTDARG00000015600
UniProt: Q6IQX2
Position
19
AA seq 1352 aa
MLSFVDTRILLLLAVTSYLASCQSGLKGPKGPRGERGPKGPDGKPGRPGLPGPAGPPGPP
GLGGNFAAQYDGAKGPDPGPGPMGLMGPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIG
ARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKG
EPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLG
SAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKG
AAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQG
PPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPG
ARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPG
NIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSG
APGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARG
PSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAG
KDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPG
ADGQTGPRGEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPG
APGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPG
EAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGG
NIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSG
AVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGLRGHPGLQG
MPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGHVGPAG
PPGSPGLPGPPGPSGGGYDTSGGYDEYRADQASLRAKDYEVDATIKSLNTQIENLLSPEG
SKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCTMDAIKAFCDFSTGQTCIHPHPESIPRK
NWYRSSQEKKHTWFGETINSGTEFAYNDETLSPQSMATQLAFMRLLANQAVQNITYHCKN
SIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCSRHTGQWSKTVIEYRTN
KPSRLPILDIAPLDIGGADQEFGLDIGPVCFK
NT seq 4059 nt   +upstreamnt  +downstreamnt
atgctcagctttgtggatacccggattctgttgctgcttgcagtgacttcgtacctagca
tcatgtcaatcgggcctcaagggaccaaaaggacccagaggtgagaggggtcctaaggga
cctgatggaaaacccggccgacctggacttcctggccctgctggccctcctggcccccct
ggtcttggtggaaacttcgctgctcagtatgatggcgctaaaggacctgaccccggccct
ggacctatgggtttgatgggacccagaggaccttctggatctcctggtgctcctggagct
caaggactgcaaggacatgctggtgagcctggagagcccggacaggctggagctattggt
gctcgtggccctcctggaccccctggcaaaaatggtgaagatggcaacaatggcagacct
ggaaagcctggagacagaggagtccttggagctcagggtgcccgtggtttcccaggaact
cctggacttcctggcatgaagggacacagaggttacaatggtattgatggacgcaaagga
gagcctggcgcagctggtgccaagggtgaaaatggtgccgctggatcaaatggaaccccc
ggacagagaggtggtcgtggtcttcctggtgagagaggtcgtgttggccctgctggccca
gctggtgctcgcggtgctgatggtaacactggtcctgctggccctgctggacctttgggc
tcagctggtcctcctggtttccctggtgcacctggacccaagggagaacttggacccgct
ggtcccactggaccatctggagctcagggacaaagaggagagccaggcccgaacggtgcc
gttggccccgttggaccccctggtaaccctggtgctaatggtatcaatggtgctaaagga
gcagctggtcttcctggaattgctggtgcccctggtttccctggccctagaggaggccct
ggcccacagggacctagtggagcttctggtccaagaggtcttggtggtgaccccggacct
gttggagtgaagggagattctggtgtgaagggagagcctggtagtgctggtcctcagggg
cctcctggtccttctggtgaggagggcaagagagggtcaactggagagcagggacctact
ggacctttgggactgcgtggacctagaggagccgctggtactcgtggtctgcctggtctg
gctggcaggtcaggcccaatgggcatgcctggtcctcgtggtggtgttggtgcacctgga
gcccgtggacctcctggagatgctggtcgtgctggtgaggctggtcttgttggagccaga
ggtctccctggtagccctggcagttctggaccccctggaaaggaaggaccttctggtgcc
gctggtcaagatggtcgcaccggaccccctggcccaactggacccagaggccagcctggt
aacattggattccctggtcccaaaggaccttctggcgaggctggcaagcctggtgagaag
ggacctgttggccctactggactgagaggcagccctggtcctgatggtaacaatggtcct
gctggtcctgttggacttgctggtgcccctggtgagaaaggagagcagggaccctctggt
gctcctggtttccagggtcttcctggccccgctggacctgttggtgaggctggcaagcct
ggtgatagaggtatccctggagatcaaggtgtatcaggacctgctggtgtgaagggagag
cgtggtaaccctggacctgctggtgctgctggcgctcagggacccattggtgctcgtgga
ccttctggtactcctggccctgatggaaacaagggagagcctggtgcagttggacctgct
ggtgcccctggaccacagggagctgctggtatgcctggtgagcgtggtgctgctggcacc
cctggagctaagggagagaagggtgaggctggatacagaggactggagggcaatgctgga
aaagatggtgcccgtggtgctcctggacccagtggaccccctggacctgctggtgctaat
ggtgacaagggtgagactggctcctttggtcctcctggacctgctggtcctcgtggtgcc
cctggtgagcgtggtgagtctggccctgctggaccttccggttttgctggaccccctggt
gctgatggccagactggaccaagaggtgagaaaggacctgctggtggaaagggtgacgct
ggacccgctggccctgccggtcccgctggaaatactggaccccttggtccttctggtcct
gttggcccacctggtgcccgtggtgacagtggtcccactggtctgactggcttccctggt
gctcctggtagagttggacctcctggtcctgctggtattgttggacctgctggtctcact
ggtcccgctggaaaggatggcccacgtggtcctcgtggtgatgttggccctgctggtccc
ccaggagagaatggaatgattggacctcttggtctggctggtgagaagggaccccctgga
gaggctggtgcacctggagcacctggacctgctgggcctcagggtcagctgggatcacag
ggattcaatggtcttcctggctccagaggtgaccgtggtcttcctggtatccccggatca
gttggtgaacctggaagagttggccctgctggtgcccctggtgcccgtggacccggtggc
aacattggcatgcctggtatgactggtcctcagggtgaggctggacgtgagggaagccct
ggcaatgatggacctcctggccgtcctggtgctgctggaattaagggtgaccgtggtgag
cctggttcccctggaactgctggacctgttggtgctcctggacccaatggaccatcaggc
gctgttggcagacctggaaaccgtggtgaatctggtccttctggtcctactggcgctgtt
ggacctgctggagcaagaggtgcacctggccctgctggacctcgtggtgagaagggtgtt
gctggagaaaaaggagacaggggtatgaagggacttcgtggacatcctggtctgcaggga
atgcccggacctaacggtccttctggtgacagtgggcctgctggcattgctggaccttcc
ggtccaagaggcccagctggtcccaatggccccgctggtaaagatggttcaaatggcatg
cctggtgcaattggacccccaggacaccgtggtcccgctggacatgttggacctgctggt
cctcctggatctcctggtcttcccggaccccctggcccatctggaggtggatatgacaca
tctggaggctatgatgagtacagagctgaccaggcctctcttagagccaaggattacgag
gtggatgccaccatcaagtccttgaacactcagattgagaatctgctttcccctgagggc
tcaaagaagaaccccgctcgtacttgccgtgacatcaggctcagccacccagaatggagc
agcggtttctactggatcgaccccaaccagggctgcacaatggatgccatcaaggccttc
tgcgacttctctactggccagacctgcatccacccccacccagagagcatcccacgcaag
aactggtacagaagctcccaggagaagaaacacacctggtttggcgagactatcaacagt
ggtactgagtttgcttacaatgacgagaccctgagcccacaatccatggctactcagctg
gccttcatgcgtctactggccaaccaggcagtccagaacatcacctaccactgcaagaac
agcatcgcctacatggatgctgagaatggaaacctgaagaaggctgtgttgctgcagggt
tccaatgatgttgagctcagggcggagggcaacagccgcttcactttcagcgtcctagag
gatggctgcagtagacacactggccagtggagcaagacagtcattgaatacagaacaaat
aaaccatctcgccttcccatcctcgacattgcacctttggacattggtggcgcagatcaa
gagtttggtttggacattggcccagtctgtttcaaataa

DBGET integrated database retrieval system