KEGG   Danio rerio (zebrafish): 336553Help
Entry
336553            CDS       T01004                                 

Gene name
cyb5r1
Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    336553 (cyb5r1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     336553 (cyb5r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 SKG6
Motif
Other DBs
NCBI-GeneID: 336553
NCBI-ProteinID: NP_956483
ZFIN: ZDB-GENE-030131-8497
Ensembl: ENSDARG00000018966
Vega: OTTDARG00000020401
UniProt: Q7ZVF8
Position
11
AA seq 304 aa AA seqDB search
MSYAMSTTVAVTVGVVLVSTAGLLGYYYFNRKRKILITLIDPSEKYKLRLVDKEIISHDT
RRFRFALPSPEHVLGLPVGKHVYLSARIDGNLIVRPYTPVSSDDDKGFVDLVVKIYFRDV
HPKFPEGGKMSQYLESLRIGDVIDFRGPGGLLEYKGAGRLDIQADKKAPAETKTVKSLGL
IAGGTGITPMLQLIRDITKNPNDTTTCSLLFANQTEKDILLKDELEEIQARHSDRFKLWF
TVDRAPADWEYSQGFISAEMIQDHLPPPSDDSMILMCGPPPMIQFACNPNLDKLGYRQSQ
RFAY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcgatgtccaccacagtagcagtgacggttggagtggtgctggtgtcaaca
gctgggctgctgggttattattacttcaacaggaagaggaaaatactcataaccctaatt
gatccttctgaaaaatacaagttgcgactagtagacaaagagatcataagtcatgatacc
cggagatttcggttcgccctgcctagtccagagcatgttttgggattaccagtgggcaag
catgtttatctctctgccaggattgatgggaatctgattgtgcgtccttacacaccggtg
tccagcgatgatgacaaaggattcgttgatctagtcgtgaagatttattttagggatgtg
cacccaaagtttcctgaagggggaaagatgtcccaatacctggagagtttgcggatcgga
gatgtgattgacttcagaggaccaggaggtttgctggagtacaagggcgcaggtcgcttg
gatatacaggccgataagaaggcccctgcagagaccaagactgtaaaatctctgggtctt
attgctggaggaacaggcattacgccaatgttgcagctgattcgtgacatcaccaagaac
ccaaatgacacgactacatgcagcctgttgtttgccaatcagactgagaaggacattctg
ctgaaggatgagctggaggagattcaggccaggcattctgatcgcttcaaactctggttc
accgtggaccgagctccggcagattgggagtacagtcagggcttcatcagcgctgagatg
attcaggaccatcttcctccacccagtgatgactctatgatcctgatgtgtggtccacct
cctatgatccagttcgcctgtaatccaaacctggacaagctgggctacaggcagagccag
cgcttcgcctattag

DBGET integrated database retrieval system