KEGG   Danio rerio (zebrafish): 336613
Entry
336613            CDS       T01004                                 

Gene name
cyfip1
Definition
(RefSeq) cytoplasmic FMR1-interacting protein 1 homolog
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
dre04810  Regulation of actin cytoskeleton
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    336613 (cyfip1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    336613 (cyfip1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    336613 (cyfip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    336613 (cyfip1)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     336613 (cyfip1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     336613 (cyfip1)
SSDB
Motif
Pfam: FragX_IP DUF1394
Other DBs
NCBI-GeneID: 336613
NCBI-ProteinID: NP_997924
ZFIN: ZDB-GENE-030131-8557
Ensembl: ENSDARG00000044345
Vega: OTTDARG00000019867
UniProt: Q90YM8
Position
6
AA seq 1253 aa
MASTVTLEDALSNVDLLEELPLPDQQPCIEPLPSSLIYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNDMLEEGQQYAVMLYTWRCCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVN
KLMNFMYFQRTAIDRFCGEVRRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMSEPSSIQESQNLSMFLANHNKITQSLQQQLEVINGYDELLAD
IVNLCVDYYENKMYLTPSERHMLLKVMGFGLYLMDGSNSNIYKLEAKKRINLTKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWSCTSTGSSPQYNVCEQMIQIREGHMRFI
SELARYSNSEVVTGSGRQDAQKTDSEYRKLFDLALQGLQLLSQWSAQIMEVYSWKLVHPT
DKYSNKECPDNAEEYERATRYNYTSEEKFALVEVLAMIKGLQVLMGRMESVFNHAIRHTI
YSALQDFAQVTLREPLRQAIKKKKNVVQSVLQAIRKTVCDWETGREPHNDPALRGEKDPK
GGFDIKVPRRAVGPSSTQLYMVRTMLESLVADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLLNFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVIAGS
LLLDKRLRAECKNQGANISWPSSNRYETLLKQRHVQLLGRSIDLNRLITQRVSSALYKSL
ELAISRFESEDLTSIMELEGLLDINRMTHKLLSKYLTLDSIDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTILPFSQEFQRDKPPNAQPQYLYGSKALNLAYSS
IYSLYRNFVGPPHIKAICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKSVCFQNLREVGNALLFCLLTEQSLSQEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLEAKYTALHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSIFEVILTRVRAYLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGAHEFTVEQCFGDGLNWAGCMIITLLGQHRRFDILDFSYHLLKVQKHDGKDEIIKSVP
LKKMVDRIRKFQILNDEIFAILNKYLKSGDGENMPVEHVRCFQPPIHQSLASN
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggcatccacagtgactctggaagatgctctgtccaatgtggacttgctggaggagctg
ccacttccagatcagcagccctgcatcgagcctctgccctcctcactcatttaccagccc
aacttcaacaccaactttgaggaccgcaatgcgtttgtgaccggcatcgcccgttacatc
gaacaggccaccgtccactccagcatgaatgacatgttagaagaaggtcagcagtatgca
gtgatgctgtacacgtggaggtgctgttcgagagccattcctcaggtgaagtgtaatgaa
caacccaacagagtggagatctacgagaagactgtggaggtgctcgaacccgaagtcaac
aaactaatgaacttcatgtactttcagaggacagcaatagatcgcttttgtggtgaagtg
cgtcgtctctgtcatgcagagcggaggaaagactttgtgtctgaagcttatctgctcact
ctgggaaagtttatcaacatgtttgcggtgctggatgaacttaagaacatgaagtgcagc
gtcaaaaatgaccactccgcctacaagagagctgctcaattcctgaggaaaatgtcagag
ccgtcatcaattcaggaatcccaaaacctatctatgtttctggccaaccacaataagatc
actcagtccctgcagcagcagcttgaagtgattaacggatacgatgagctgttggcagac
attgttaacctgtgtgtggattactatgaaaacaagatgtacctyacccctagtgagaga
cacatgctactcaaagtaatgggctttggtctctatctcatggatggaagtaacagcaac
atctacaaactggaagctaagaagagaatcaacctcacaaagatcgacaagttctttaag
caattgcaggtagtgcctctgtttggtgacatgcagattgaattggctcgctatatcaaa
accagcgctcactacgaggaaaacaagtctaggtggtcatgcacgtcaacaggcagtagc
ccacagtacaatgtctgcgaacagatgattcaaatccgggagggccacatgcgcttcatt
tctgaattggctcgatacagcaacagtgaggtggtgactggctctgggcgtcaggacgct
cagaagacggactctgagtacaggaagttgtttgatctggctctgcagggcctgcagctg
ctctctcagtggagcgctcagatcatggaagtgtattcctggaaattggtgcatcctaca
gacaaatactccaacaaagaatgccctgacaatgctgaagagtatgagcgtgctaccaga
tacaactacaccagtgaggagaaatttgctctggtggaggtcctcgccatgataaagggc
ttgcaggtactgatgggccgaatggaaagtgtgtttaaccacgccatccgtcacaccatt
tattcagctctgcaagactttgcccaagtcacgctccgtgaaccgctgcgccaggccatc
aagaaaaaaaagaatgtcgtccagagtgtcctccaggccatccgtaagaccgtctgtgat
tgggaaacaggcagagagccacataatgacccagcgctgcggggagagaaggaccctaaa
gggggatttgatatcaaagtccctcgtcgcgctgttggaccctccagcactcaactgtat
atggtcagaacaatgctggagtctctggtcgcagataagagcggatcaaagaagaccttg
cgcagtagtctggaggggccgaccattctggacatcgagaagtttcatcgcgaatccttt
ttctacactcatctgctcaacttcagtgagactctgcagcagtgctgtgatttgtcccag
ctctggtttcgggagttctttctggagctcactatgggccgccgcatccagttccccatt
gagatgtccatgccctggatccttaccgaccacatcctggagactaaagaggcgtctatg
atggagtacgtgttatattctctggatttgtacaacgacagtgcacactacgctctcact
aagtttaaaaagcagttcctttatgatgagattgaagcggaggtgaacctctgctttgac
cagtttgtctacaaacttgctgatcaaatatttgcctactacaaggttattgccggaagt
cttcttctggataaaagactaagagccgaatgtaagaaccagggtgcaaacatctcatgg
ccttcctccaatcgttatgagacactcctgaaacagagacacgtccaactccttggacga
tcgattgacttgaaccgcctgatcactcagcgtgtgtcttctgcgctttacaaatccctg
gagctggccatcagccgcttcgagagcgaggacctcacctccatcatggagttggaaggt
ttgttggacataaaccgaatgacccataaactcctcagtaagtatttgacactggacagc
atcgacgccatgttccgagaggcaaaccacaacgtttccgcaccctacggcagaatcact
cttcatgtcttctgggagttgaactatgacttcttgccaaactactgttacaatggctcc
acgaacaggtttgttcgcaccattctgccgttttcacaggagtttcagagagacaagcct
cccaacgctcagccacagtacctgtatggctcaaaggccttgaatttggcatacagcagc
atatacagcctctaccgcaactttgtgggacctccacatattaaggctatttgcagactt
ctgggataccagggaatcgctgtggtgatggaggagctgttaaaagttgtcaaaagcctg
ctacaaggcaccatccttcagtatgtgaagacattgatggaagtgatgcccaagatttgc
cgtctgcctcgccatgagtatggctcaccaggtatcctggagttcttccaccaccagctg
aaagacattgtggagtacgctgagctgaagtcagtgtgcttccagaacctgagggaggtt
ggaaacgcattgctcttctgccttctgactgaacagagcttgtctcaagaagaggtgtgc
gacttgttgcacgcagctcccttccagaacatcctaccaagggttcacgtcaaagaagga
gagcgtctggatgcaaagatgaagcgtttggaggccaaatacacagcgctgcatctggtg
cctctgattgaacgtctgggaacccctcagcaaatcgccatcgcccgtgagggagacctg
ctgactaaagagcgtctgtgttgcggactctccatatttgaggttattctgacacgcgtc
cgcgcttacctggacgacccgatctggcgtgggcctttacccagcaatggagtgatgcat
gtagacgagtgtgtggagtttcaccggctgtggagcgcaatgcagtttgtgtactgcatc
cctgtgggcgcacatgagttcactgttgagcaatgtttcggagacggtctgaactgggct
ggttgcatgatcatcactttactcggtcagcacagacgctttgacatcctggacttcagc
taccatctcttgaaggtgcagaaacacgacggtaaagatgagatcatcaagagcgtgcct
ctgaagaaaatggttgaccgaattcgcaaattccagattctgaacgatgagatcttcgcc
attttgaacaagtacctgaagtctggagatggagagaacatgccagtagaacacgtgcgg
tgctttcagcctcccatccatcagtctttggccagtaactga

DBGET integrated database retrieval system