KEGG   Danio rerio (zebrafish): 336867
Entry
336867            CDS       T01004                                 

Gene name
sgta
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    336867 (sgta)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   336867 (sgta)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_2 TPR_8 TPR_11 TPR_7 TPR_17 TPR_14 TPR_10 TPR_12 TPR_9 TPR_16 TPR_19 Fis1_TPR_C NARP1 TOM20_plant TPR_6 DUF627 MIT ANAPC3
Other DBs
NCBI-GeneID: 336867
NCBI-ProteinID: NP_997929
ZFIN: ZDB-GENE-030131-8811
Ensembl: ENSDARG00000019941
UniProt: Q6NXA1
Position
11
AA seq 320 aa
MADTKHIAFSIIQFLRDQLSSGGLSSDAQESLEVAIQCLETTFGISVDDQNLAVSQSLPE
LFAFATKQTGTTQENTFVTTGSPYEHQLAEAERLKTDGNDQMKVENFSAAVEFYSKAIQL
NPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGIDANYSKAYGRMGLALASLNKYSEAVS
YYKKALELDPDNDTYKVNLQVAEQKVKETQPSTAGGLGGVDLAGLLSNPGFMNMASNLMN
NPQVQQLVSGMMSGSYSPVSSATSPTAAGAGGGGANDLSSLIQAGQQFAQQMQQQNPELI
EQLRSQMRSRPPSSAGNDEP
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcagacacaaagcatattgcattctccatcatccagtttctccgtgaccagctgtcc
tctgggggtctgtcatcagatgcacaagaaagtttagaagttgctattcagtgcttggag
acaacatttgggatttctgtagatgaccagaacttagcagtcagtcagtctctgccagag
ttatttgcttttgcaactaaacagactggtacaacacaagaaaacacatttgtaaccact
ggatcaccttatgagcatcagttagcagaggctgagcgtcttaaaacagatggaaatgat
cagatgaaagtggaaaactttagtgcagctgtggagttttactctaaagccatccagctt
aatcctcaaaatgctgtctacttttgcaacagagctgcagcatacagcaagctagggaac
tatgctggagctgttcaagactgtgaacgtgccattggaattgatgcaaactacagtaaa
gcatatggacgaatggggcttgctcttgcaagtttgaacaaatactcagaggctgtgagc
tattacaagaaagcactggaactggaccctgacaatgacacctacaaagtcaaccttcaa
gttgcagaacagaaggttaaggaaacacagccaagcacagcaggggggttgggaggagtc
gatctggctggtttgctgagtaaccctgggttcatgaatatggcatctaatttaatgaac
aaccctcaagtgcaacaacttgtatcaggtatgatgtctgggtcttacagtcccgtaagt
agtgccacctcaccaacagctgctggagcaggaggtggtggtgccaatgacctctccagc
ctcatacaggctggacagcagtttgcacaacaaatgcaacagcagaatcctgagcttatt
gaacagctgaggagtcaaatgcgcagccgacctcccagtagtgctggcaatgatgaaccc
tga

DBGET integrated database retrieval system