KEGG   Danio rerio (zebrafish): 353222Help
Entry
353222            CDS       T01004                                 

Gene name
gnrh2
Definition
(RefSeq) progonadoliberin-2 precursor
  KO
K05252  gonadotropin-releasing hormone
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    353222 (gnrh2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    353222 (gnrh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GnRH
Motif
Other DBs
NCBI-GeneID: 353222
NCBI-ProteinID: NP_852104
ZFIN: ZDB-GENE-030516-1
Ensembl: ENSDARG00000044754
Vega: OTTDARG00000034865
UniProt: Q5Y835
Position
21
AA seq 86 aa AA seqDB search
MVLVCRLLLVMGLMLCLSAQLSSAQHWSHGWYPGGKREIDLYDTSEVSEEVKLCEAGKCS
YLRPQGRNILKTILLDALIRDFQKRK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggtctgcaggctgctgttggtcatggggctgatgctgtgtctgagtgctcag
ttgagcagcgctcagcactggtctcacggctggtatcctggaggaaagagagagatagac
ctctacgacacctcagaggtttcagaggaagtgaagctctgcgaggcaggaaaatgcagt
tacctgagaccgcagggaagaaacatcctcaagacaatactgctggatgccctcattcgt
gatttccaaaagagaaagtga

DBGET integrated database retrieval system