KEGG   Danio rerio (zebrafish): 368228
Entry
368228            CDS       T01004                                 

Gene name
penka
Definition
(RefSeq) proenkephalin a precursor
  KO
K18832  proenkephalin A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    368228 (penka)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    368228 (penka)
Transporters [BR:dre02000]
 Other transporters
  Pores ion channels [TC:1]
   368228 (penka)
SSDB
Motif
Pfam: Opiods_neuropep Op_neuropeptide IATP Brucella_OMP2
Other DBs
NCBI-GeneID: 368228
NCBI-ProteinID: NP_956377
ZFIN: ZDB-GENE-030729-31
Ensembl: ENSDARG00000004869
Vega: OTTDARG00000019605
UniProt: A8E7S2
Position
2
AA seq 237 aa
MALMMNSWWTVALSACLVLMVRAECGRDCALCVYRLLRQTDIDTLACTLECEGSVDSRKI
EICKNILTEEDRLAIDSLKQDEESANHVLAKKYGGFMKRYGGFMIKKAAEIGTGAPAESD
GTGAISKKYGGFMKKADDGAEDQQVELLREILRVGLSSESDDQPDGDMVKRYGGFMRSVQ
ENTGRDLHKRYGGFMRRVGRPDWLDNQKSGGLLKRTWEEGGETALPDMQKRYGGFMD
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcgttaatgatgaactcctggtggactgtggctttgagcgcctgtctcgtgctcatg
gttcgggctgaatgcggcagagactgcgcgctctgcgtttaccggctcctccgacagaca
gacatcgacacactggcctgcacattagaatgtgaagggtctgtggactccagaaaaatc
gaaatctgtaaaaacatcctcaccgaagaggatcgccttgccatcgacagcctcaagcaa
gatgaagagagtgcaaaccatgttctcgccaagaaatatggtggcttcatgaagcgttac
ggcggctttatgattaaaaaagcagcagaaatcggtacaggagccccagctgagagtgac
ggcacaggggccatcagtaagaaatatggaggctttatgaagaaggcagacgatggagct
gaagaccaacaggtggagctcctgcgagagatcctccgagttggactctcttcagagtca
gatgatcagcctgatggggacatggtcaaacgctatgggggcttcatgaggagtgtacag
gagaacactgggagagacctgcacaagagatatggtggctttatgcgaagagtgggcagg
cctgattggttggacaaccagaaaagcggtgggcttctgaaacgcacttgggaggaagga
ggcgagacggcgctgcccgacatgcagaagagatacggaggattcatggattag

DBGET integrated database retrieval system