KEGG   Danio rerio (zebrafish): 368262Help
Entry
368262            CDS       T01004                                 

Gene name
dlst
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00020  Citrate cycle (TCA cycle)
dre00310  Lysine degradation
dre01100  Metabolic pathways
dre01200  Carbon metabolism
Module
dre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dre_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    368262 (dlst)
  Amino acid metabolism
   00310 Lysine degradation
    368262 (dlst)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     368262 (dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 368262
NCBI-ProteinID: NP_958895
ZFIN: ZDB-GENE-030326-1
Ensembl: ENSDARG00000014230
Vega: OTTDARG00000020536
UniProt: Q7ZVL3
Position
17
AA seq 458 aa AA seqDB search
MLCHSRCLSRSLGRSITALRQGNSVLARRATSGIAASQCVSFQDSPRCETRSSVYQIRYF
KTTAAHRNEVITVKTPAFAESVTEGDVRWEKAVGDSVAEDEVVCEIETDKTSVQVPSPAA
GVIEELLVPDGGKVEGGTPLFKLKKGAGAVKTAAAVGAPPPAAKTPAPAAPAPAAAPAGG
PIPSSMPPVPAVPAQPIQAKPVSAIKPTAAAPAAAAADTGAKAPRSEHRVKMNRMRLRIA
QRLKEAQNTCAMLTTFNEVDMSNITEMRTHYKDAFLKKHGIKLGFMSAFVKAAAYALTDQ
PAVNAVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRGVEGMNFADIEKTINELGEKAR
KNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIAGKVEVRPM
MYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcattcccgctgtctgagccggagcctcggccgctcgatcaccgccctgaga
cagggtaacagtgttctcgcaagacgggctacatcaggtatagcagctagtcagtgtgtc
agcttccaggacagcccgaggtgtgagacccgctctagtgtctatcagatcagatacttc
aagaccacagccgctcacaggaatgaagtcattacagtaaaaaccccagcgtttgcggag
tctgtcacagagggagatgtcaggtgggagaaagctgttggagactcagtcgctgaggat
gaggtcgtctgtgaaatcgagaccgataagacgtcagtgcaggtcccctctccggctgca
ggagtgatcgaggagctgctggttcctgatggaggaaaagtggaaggaggaactcctctg
ttcaagctcaagaaaggagctggagcggtgaagacggcagcagcggtgggggctcctcct
ccagcagcaaagacccctgctcctgcagcccctgcccctgctgctgcccctgcgggtgga
cccataccctccagcatgcctcctgtacccgctgtgccagcccagcccatccaggccaaa
ccagtttcagccatcaaacccactgctgctgctcctgctgctgctgctgcagacactgga
gctaaagctccccgatcagagcacagggtgaagatgaaccgcatgcgactgcgaatcgct
cagcggctgaaggaagcgcagaacacctgtgccatgctgaccaccttcaatgaagtcgat
atgagcaacatcacagagatgaggacacattataaagatgctttcctgaagaaacacggc
atcaagctgggcttcatgtctgccttcgtcaaagctgcagcctacgctctaacagaccag
cctgccgttaatgctgtcattgatgacacaaccaaagagatcgtgtatcgggattatgtg
gacatcagtgtggcggtggcgacaccaaagggtctggtggtaccggtgatcagaggtgtg
gagggaatgaacttcgcagacatcgagaagaccattaatgagctgggagagaaggcccgt
aagaatgagctggctgtggaggatatggatggaggaacgtttaccatcagcaatggagga
gttttcggctccatgttcgggactccaatcatcaacccgccacagtctgccatcctgggc
atgcatggcatcttcgaccggcctgtggccatcgctggcaaggtggaggtgcggccgatg
atgtacgtggctctgacctacgaccaccgcttgattgacggcagagaggcggtcactttc
ctcaggaagatcaagtctgtggtggaggacccgcgggtgctgctgctggacatgtaa

DBGET integrated database retrieval system