KEGG   Danio rerio (zebrafish): 368273
Entry
368273            CDS       T01004                                 

Gene name
trpn1
Definition
(RefSeq) transient receptor potential cation channel, subfamily N, member 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 Ion_trans PKD_channel DUF4633
Other DBs
NCBI-GeneID: 368273
NCBI-ProteinID: NP_899192
ZFIN: ZDB-GENE-030728-7
UniProt: Q7T1G6
Position
19
AA seq 1614 aa
MSESSCVSGAPQRLVPLALRGEWMALEQKIKTLERGDPDILQCDEESGMSLLMLAVRESR
LSVLDRLLELGANPSDKTKDGRSALHIAAAHSKDEIVKLLVRKTDPNSPAGPNDQLPLHY
AASRSTGGLAVVQTLLKFSSKDARLTPDKNGCLPLLLAAEAGNVGIVRELLSSQSEPQIR
AAKTANGDTALHICCRRRDVEMAKILVEFGANPDSQNDEGQTPLHIAAHEGDENMLKFLY
LCKANANISDKMDRSPLHIAAERGHTNVVEILTEKFRSCVLARTKDGNTLLHIASQCGHP
TTALSFLRKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLQKGAHVDAAARDGQTALHIA
VENCRPQVVQMLLGFGAHVQLRGGKAQETPLHISARVKEGERAAEMLLKSGAEVNAEQEN
GETALHVAARHGSLQMIRALIQEGGDPRWRSRVGESPLHVAVRHCHAHVVQEILTFLTNE
KSRRDAELCVCEGNQDGETALHLAAELRTDALHQPEEDITIIQILMEHQADITAVTRQTG
ETPLHYSARVGNTAVLQEMLRNVPTNQIQTAINKHSKNGWSPLLLAADQGHTEVVKILLQ
NNARVDVFDEEGKAAIHLAAQRGHQDIVDVLLSQKAFVNAKTKQGLTPLHLSAQNGSARL
VRLLVENHQASVDALSLRKQTPLHLAAMSGQLDVCSSLLNLRADITATDSRGQTPLHLAA
ESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKA
HGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPL
KIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTISGKDDIKRQQPLAESGFT
PLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLL
HQADRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLV
ESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLLDDKKFIFNLMVCGRMND
NLSLEELVLHTSAPLDTAVRLSRALTLCALREKERSVDLQAAAHHCELMASDLLSLSASA
GGQGAGAGPILRALDHRGLSVLDCLIEGRQKGVVSQPAVQTYLTEVWCGGLQWDSWKILL
LFCCLLLCPPLWLLLALPLTHSFNTIPIVKFMSHLVSHIFLLTLFILTIVYPPVSPLSQA
RLMPSWSECLLLIWLCGMLVSELTFPGERTGLAWIRLLLLGFSAAALLCHLLAVFTQWWP
PTHLHCLFARNVLLAVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILMLFH
TAFTLSLTALCQPLYPQEQHNTTTEVTVPGPLNMSVLLFFALFGLTEPDKIPDVDRSPPA
TAVLAKMVFGVYLVVTFIVLINLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGI
PSPFNLFTNLFYSVKVVCKRAGKMCSSESRDVMNEDEDAEGLSESRSLDLLSQASVSGIR
GNKRTQILPEGGQISLAHSGGHVRVENVADWPSVVQQFLSQRRQRDRSTAERDE
NT seq 4845 nt   +upstreamnt  +downstreamnt
atgtctgagagctcgtgtgtctccggggccccgcagcgcctggtgcctctggcgctccgc
ggagagtggatggcgctggagcagaagatcaagactttagagagaggagatccggacata
cttcagtgcgatgaggagtcgggtatgagtctgctgatgctggcggtgcgggagagccgt
ctgtcagtcctcgacaggttactggagctcggggctaatccaagcgacaaaaccaaggat
ggcagatcagctttacacatcgccgctgctcactccaaagacgagatcgtcaaactgctg
gtcagaaaaactgaccccaattcaccagcagggcccaatgatcagctgcctctgcattac
gctgcatctcgatccaccggaggcctcgctgtggtgcaaaccctgctcaagttcagcagt
aaagacgctcgactgacacctgacaagaacggctgtcttccgctgctgctggctgccgaa
gccgggaatgttggaattgttcgggagctactctccagccaatcagagcctcagatcaga
gctgcaaagaccgcaaatggagacacagcgcttcacatctgctgcagacggagagatgta
gagatggccaaaatcctggtggagttcggggccaatccagattctcagaatgatgaaggt
cagactcctctacacatcgcagctcatgaaggagacgagaacatgctgaagtttctgtat
ctctgcaaggccaatgctaacatctctgacaagatggacagatctcctctccacatcgca
gcagagcggggacacaccaatgtagtggagatcctcaccgagaaattcaggtcctgtgtg
ttagcaagaaccaaggatggaaacactctcctgcacatcgcgtctcagtgcggtcatccc
accactgctctcagcttcctgaggaagggcgtcccgctgcacatgcccaacaagtctgga
gcagtgtgtctgcatgcggccgctaagcgcggacacacagctgtagtgaaggctctcctc
cagaagggggcgcatgtggacgcggcggcgcgagacggacagacggcgctgcacatcgcg
gtggagaactgcagaccgcaggtggtgcagatgctgctgggcttcggtgcgcacgtgcag
ctcagaggaggaaaggctcaggaaactcctctccacatctcagcgagggtgaaggagggt
gagcgtgcggcagagatgctgctgaagagcggagcggaggtcaacgcagagcaggagaac
ggagagacagctctgcatgtggcagcacggcacggctctctgcagatgataagagccctc
attcaggagggaggagaccccagatggagatccagggttggagagagtcctctgcatgtg
gcggtgcgtcactgtcacgctcatgtggtgcaggagattctaacttttctgaccaatgag
aagagccgacgggatgcagaactctgcgtgtgtgaaggcaaccaggacggagagacggcg
cttcatctggcagcagagctcaggacggatgcgcttcatcagccggaggaggacattacc
atcatccagatcctgatggagcatcaggctgacatcactgcagtcacacgacagactgga
gagacgcctcttcattacagcgccagggtgggaaacactgcagttctgcaggagatgctc
aggaacgtccccacaaaccagatccagacggccatcaacaaacactccaagaacggctgg
tctcctcttctattggctgcagatcagggtcacacagaggtggtgaagatcctgctccag
aataacgcccgagtggacgtcttcgatgaggagggaaaggcagccattcatctcgcagca
caacgcggtcatcaagacatcgtggacgtcctgctgtcccaaaaggcttttgtaaacgcc
aaaaccaagcagggcctgacgcctctccatctgagtgctcagaacgggtcagcgcggctc
gttcggctgctggtggagaaccatcaggccagcgttgatgctctgtctctgaggaagcag
acgccgctgcatctggccgccatgagtggacagctggacgtctgcagcagcctgctgaac
ctccgagccgacatcactgccaccgacagccgaggtcagactcctctccatctggcggcc
gagagcgatcattcagaagtggtgaagttgtttctgagactcagacctgagttatcgaca
ctagcgaacgaggatgggtcgacatgcacacacatcgctgcggccaaagggagtgtgtct
gtcatcagagaactgctcatgtttaaccaaggaggagtcggcacgctcaaccacaaggct
catggtttgtgtcctcttcatctggctgctgctggtggacacgctgaggtggtgaaggtc
cttctggaggctggagcgtcagtgacagaggaggacgcagagggcatgacagctgttcac
ctggcagccaaacacggccacacacacatcctggaggtgctgagaggaagcgttcccctg
aagatccagagctctaagacggggtttacagctctgcatgtggcggcctctttcggacag
atgaatttcgtcagagaaatcctgactaaagttcctgcgacgatacgaagtgaattcccc
acaatcagcggcaaagacgacataaagagacaacagccgttagctgagtcaggtttcact
cctcttcatctggcgtctcagtcgggtcatgagagtgtggttcgcctgctgctgaactgt
cctggtgttcaagccgatgcagaaacaaacattcagggctccagtcctcttcatctggcg
gctcagagcgggcacacagcagtggtgggtctcctgctcagccgatcctcatctctgctc
catcaggcggacagacggggacgctctgctctgcatctggctgccgcacatggacatgtg
gacatggtgcgagtcctgctgggacagggagctgaaatcaatcataccgacatgagtggc
tggacagcgctgcattacgctgctgaagccggctgtctggaggtgttgttgtttctggtg
gagagcggagcgtccgcctgtgctgagtgtcacggtggacgaacgccgctgcagtacgct
gctcagcagaaccacgagtccgctgtcatattcctgctcagacgagagaaaaacacactc
cggctgctggacgacaagaagttcatattcaatctgatggtgtgcgggcgaatgaatgat
aatctgtctctggaggagctggttttacacacatctgctcctctggatactgcggtgcgt
ctatctcgagctttgaccctttgtgcgctgagagagaaggagcgttcggtggatctgcag
gctgcagcgcatcactgtgagctcatggcgtccgatctgctgtctctatctgcatctgct
gggggtcagggagctggcgcaggccccatacttagggctctggaccacagggggctcagt
gtgttggactgcctgatcgagggccggcagaagggcgtggtatcccaaccggcagtgcag
acgtacctgacggaggtgtggtgtggaggtctgcagtgggactcctggaagatcctgctg
ctgttctgctgtttacttctgtgtccgccattgtggcttctgctcgctctgccactcaca
cacagcttcaacaccatcccaatcgtgaagttcatgagccacctggtgtcccacatcttc
ctgctgactctgttcatcctgaccatcgtgtacccgcccgtgagtcctctatcccaggcc
cgtctgatgcccagctggagcgagtgtctgctgctcatctggctgtgtgggatgctggtc
tctgagctgacattccccggagagcgcactggattagcctggatccgtctgctgcttttg
ggtttttctgctgctgctctgctctgccacctgctggcggtgttcacmcaatggtggccg
ccaacacacctgcattgtctattcgctcgtaacgtactgctagccgtcgccatgacactc
ggtttcatccagcttctggaattcctcacatttcatcatttattcgggccgtgggcgata
atcatcagagacttgattaaagatctgtgcagatttgctgtgatcctgatgttgtttcac
actgcatttacactgagtctcaccgcattatgccagccgctttatccacaagaacagcac
aataccacgacagaagtgaccgttcctgggccgttaaatatgtccgtgctgctttttttt
gcgttgtttggtttgactgagcctgataaaatccccgatgtggatcgatcgcctcctgct
acggcggtgttggctaaaatggtgttcggtgtgtatctggtggtgacgtttatcgtgttg
attaatctgctgattgcgatgatgagcgacacatatcagcgaatacaggctcagtccgac
accgagtggaagtttggccgtgctgttttgattcgagatatgagccgcaaatctggcatc
ccgtctccgtttaacctgttcaccaacctgttctactccgttaaagttgtctgcaaacgt
gcaggcaagatgtgctcgtcggagtctcgtgatgtgatgaatgaagatgaagatgctgaa
ggtttgtcggaatctcgatctctggatcttctgtctcaagcatctgtcagcggcatcaga
ggaaacaagaggacacagatcctgccggagggtggtcagatctcattggcccattccgga
ggtcatgtgcgtgtggagaatgttgctgattggccgtcggtggtccagcagtttctgtct
cagcgcaggcagagagacagatcaacagcagagagagacgagtga

DBGET integrated database retrieval system