KEGG   Danio rerio (zebrafish): 368348Help
Entry
368348            CDS       T01004                                 

Gene name
cmtm6
Definition
(RefSeq) CKLF-like MARVEL transmembrane domain-containing protein 6
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL SUR7 DUF2070
Motif
Other DBs
NCBI-GeneID: 368348
NCBI-ProteinID: NP_001038221
ZFIN: ZDB-GENE-030729-15
Ensembl: ENSDARG00000099631
Vega: OTTDARG00000036516
UniProt: Q1LYM1
Position
16
AA seq 189 aa AA seqDB search
MATQDPVYNTTTTAPAQANKSKGWFNVPSENLETIRFVIKVVEMLLSFVAFVMEEVVSHC
ASCGPLYFFEFVSCTAFLFTLLLLILLATSLHQRVGIKCWPTLDFTYTSGMAVMFLIASI
VFAAGNGRTGLEQGAVAFGFMSTIAFFAEAAYFVKLHGIPCLKRNNLPADATPRQPEIEK
LNANGAESA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaagacccggtgtataacaccaccacaacagcaccagcacaggcaaacaaa
tctaaaggatggttcaacgtgccatcagaaaatctggagacaatacgatttgtgataaaa
gtggtcgaaatgctgctgtcgtttgtggctttcgtgatggaggaggtcgtgtcccactgt
gcgtcttgtggaccgctttacttctttgagtttgtgagttgcacagccttcctcttcaca
cttctgctcctcatccttctggcaacaagtctccaccagagagtcggaattaagtgctgg
cctacactggattttacatacacatcaggcatggcagtcatgttcctcattgccagcatt
gtgtttgcagcaggcaatggtcggacgggcttggagcagggtgcagtggcatttggcttc
atgtccacgatagccttctttgcagaagctgcttactttgtgaaactgcatggtattccg
tgccttaagagaaacaatctaccagcagacgcaacaccaagacaaccagagattgagaaa
cttaatgctaatggagcagaatctgcttga

DBGET integrated database retrieval system