KEGG   Danio rerio (zebrafish): 368421Help
Entry
368421            CDS       T01004                                 

Gene name
gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    368421 (gpr161)
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    368421 (gpr161)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srsx PIG-Y
Motif
Other DBs
NCBI-GeneID: 368421
NCBI-ProteinID: NP_001007200
ZFIN: ZDB-GENE-030616-58
Ensembl: ENSDARG00000055659
Vega: OTTDARG00000001280
UniProt: Q90X46
Position
9
AA seq 527 aa AA seqDB search
MNGSKNGTAVANSTNGLDDNGLMVLESVSIIIIAILACLGNLVIVVTLYKKPYLLTPSNK
FVFSLTSSNLLLSVLMLPFVVASTVRRDWMFGVVWCNFTALLHLLVSSSSMLTLGAIAID
RYYAVLYPMIYPMKITGNRAVLAIVYIWLHSLVGCLPPLFGWSSFEFDRFKWTCTVSWHK
EISYTAFWVTWCCLLPLVAMLVCYGVIFRVARIKARKVYCGSVVVSQEESSSQNNGRKNS
NTSTSSSGSRKSLIYSGSQCKAFITILVVLGTFLTTWGPYVVVISTEALLGKNSVSPQVE
TLVSWLSFTSAVCHPLIYGLWNKTVRKELLGMCFDDRYYRESFVIRHRTSRLFSISNRIT
DLGMSPHLTAMLVGGGQLLGRGSSTGDTGFSYTQDSATDVMLLESYTSEASHSAHCTANK
RRSSVTFEDQVDHIPQGDPSVVQVTADIHKSLDSFASSLAKAIENDAKLQLLGEWTQIPT
SLFTVRNTQRVPRYLDGQRLRMESIDEGIVKDDDDDEEEEMEREEKM
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctctaagaatgggacggcggtggccaactccactaatggcctggatgacaac
gggctcatggtcctggagtctgtctctatcatcatcatagccatactggcatgtctgggg
aatctggtcattgtggtgactctttataaaaagccctacttgctaacacccagcaacaag
tttgtcttcagcctgacttcatccaatttactattatcagttctaatgctgccgtttgtt
gtggccagtacggtgcgtcgggattggatgtttggggtggtgtggtgcaatttcacagct
ctgctccatctacttgtcagctcatctagcatgcttacacttggagccattgccattgac
aggtactatgcagtattataccccatgatctaccccatgaaaatcaccggaaatcgagct
gtgcttgcaatcgtttacatctggctccattccctagttggctgcctgccgcctcttttc
ggatggtcatcgtttgagtttgaccgcttcaaatggacctgcacggtgtcctggcacaag
gagatcagctatacggccttttgggttacatggtgttgccttttgccgctggtggccatg
ttggtctgctacggagtcattttccgcgtagctcgcatcaaagctcgtaaggtttattgc
ggcagtgttgtggtgtctcaagaagagtccagctctcaaaataacggccgcaaaaactcc
aacacctcaacatcttctagtggcagccgcaaaagcctgatttactctgggagccaatgc
aaggccttcatcaccattttagtggttctggggacatttctgaccacttggggtccttat
gtggttgttatcagcaccgaagcactattagggaaaaatagtgtttctccacaagttgag
acgctggtttcttggctgtcttttaccagtgctgtgtgtcatccacttatttatgggctg
tggaacaagactgtacgcaaggagctgttggggatgtgttttgacgatcggtactacaga
gagtcatttgttatacggcaccggacctctcgtctgtttagcatctcaaaccggataaca
gatttagggatgtctcctcatctgacggccatgttggtgggtggaggtcagcttttgggc
cgtggaagcagcactggagacactggcttcagctacacacaagactcagcaacagacgtc
atgctgttggagagctacacctcagaggcgtcccactcagcccactgcaccgccaataag
aggaggagctcggtcacattcgaggaccaagtggatcacataccacaaggtgacccttca
gtagtccaagtgacggcagacatccacaaatctttggacagttttgcatcctctctggcc
aaggctatagagaacgacgccaaacttcagctcttaggagaatggacacaaattcccaca
agtctgttcacagttcgaaacacacagcgagtgcctcggtatctggacggacagagactc
aggatggaaagcatcgatgaaggaatagtcaaagatgatgatgatgatgaagaagaagaa
atggagcgcgaggaaaaaatgtag

DBGET integrated database retrieval system