KEGG   Danio rerio (zebrafish): 368703
Entry
368703            CDS       T01004                                 

Gene name
si:busm1-104n07.3
Definition
(RefSeq) H-2 class II histocompatibility antigen, E-S beta chain
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set MHC_II_beta C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 368703
NCBI-ProteinID: XP_005167291
ZFIN: ZDB-GENE-030616-99
Ensembl: ENSDARG00000074510
Vega: OTTDARG00000032582
UniProt: F1QVI4
Position
8
AA seq 250 aa
MSLLRLFYGHLILTLSVLIGAETANVYYRYTWIQCISSSKNLSDMVFIESLYFNKYLFTQ
FNSNIGKYVGFSEYGIRNAEFRNNDTNLLLKKKAAVNKVCKNNAINHDKFIRNKAVKPKV
KLTLVKPAGGRHPAVLMCSAYEFYPPHIRVYWLRNGEVITSDVTSTMEMADGDWYYQIHS
ELEYSPKSGERISCGIEHASSNKPIITEWDSSRPASERNKIAIGASGVVLGIIIPAICFI
YYKKTAEAVL
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtcactgcttaggcttttctatggtcatctcatattgacgttgtctgtattaattgga
gctgaaacagctaatgtatattacagatacacttggatacaatgcatctccagctctaaa
aatcttagtgacatggtgtttattgagagcctttatttcaataaatatctatttacacag
tttaatagtaatattggaaagtatgtggggtttagtgagtacggcattagaaatgcagaa
tttaggaacaatgacaccaatttactgcttaaaaaaaaagctgcggtgaacaaagtctgc
aaaaataatgctatcaaccatgacaaatttattcgcaataaagcagtgaaaccaaaggtt
aagctcactttagtgaagccagctggtggaagacatcctgcagttttgatgtgcagcgcg
tatgaattttatcctccacacatcagagtgtactggctgagaaatggtgaagtgataacc
tctgatgtgacatcaactatggagatggctgatggagactggtattaccagattcactct
gagctggagtacagcccaaaatctggagaaaggatctcatgtgggattgaacatgccagc
tctaataaacccatcattacagagtgggattcatctcgtcctgcgtctgagaggaataaa
atcgccattggggcatctggtgtagttctgggaatcatcatcccagctatatgttttatt
tactacaagaaaactgcagaagcagttttgtga

DBGET integrated database retrieval system