KEGG   Danio rerio (zebrafish): 368912Help
Entry
368912            CDS       T01004                                 

Gene name
echs1
Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00062  Fatty acid elongation
dre00071  Fatty acid degradation
dre00280  Valine, leucine and isoleucine degradation
dre00310  Lysine degradation
dre00380  Tryptophan metabolism
dre00410  beta-Alanine metabolism
dre00640  Propanoate metabolism
dre00650  Butanoate metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01212  Fatty acid metabolism
Module
dre_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dre_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
dre_M00085  Fatty acid biosynthesis, elongation, mitochondria
dre_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    368912 (echs1)
   00650 Butanoate metabolism
    368912 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    368912 (echs1)
   00071 Fatty acid degradation
    368912 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    368912 (echs1)
   00310 Lysine degradation
    368912 (echs1)
   00380 Tryptophan metabolism
    368912 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    368912 (echs1)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     368912 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 368912
NCBI-ProteinID: NP_001004529
ZFIN: ZDB-GENE-030616-617
Ensembl: ENSDARG00000001578
Vega: OTTDARG00000041750
UniProt: Q7ZZ04
Position
13
AA seq 291 aa AA seqDB search
MALLCRSTGLLLKHSKLLPSALAATRQSSSGVQYEYILVDKKGEKKNVGFIQLNRPKALN
ALCDGLMLEVGKALDAFEMDSEVGAIVVTGSEKAFAAGADIKEMQNRTFQECYGGNFLAH
WNRVSTVKKPVIAAVNGFALGGGCEFAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRL
TRAVGKSLAMEMVLTGDRISAQEAKQSGLVSKIFPVDQLVPEAIKCGEKIAGNSKLVSAM
AKESVNAAFELTLAEGSRFEKRLFHATFATEDRKEGMSAFVEKRKAAFQDK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctctgcagatcaacagggttacttctcaaacacagcaaactgctgccctct
gctttagcagcgacaaggcaatccagttcaggtgtccagtatgagtacattctggtggac
aaaaagggtgaaaagaagaatgttggcttcatccagctgaacagaccaaaggccctgaat
gctctttgtgatggactcatgctggaggtgggcaaagcgctcgatgcatttgagatggac
agtgaagtgggagcaatcgtcgtcaccgggagtgaaaaagcctttgcagctggtgctgac
attaaagagatgcagaatcgaaccttccaagagtgttatggtggaaacttcttggcacat
tggaacagggtatcaacagtcaagaagcctgttattgctgcggtcaatgggtttgcgctt
ggcggaggatgtgagtttgctatgatgtgtgacatcatctatgctggagagaaggcacag
ttcggacagccagaaatcctgcttgggaccattcctggtgctggtggcactcagaggctt
acaagagcagttggaaaatcccttgcgatggagatggttctcactggagaccgaatctca
gcccaggaggcaaaacagtctggcctggttagtaaaatatttcctgtggatcagctggtt
ccagaagcgatcaaatgtggagagaaaatcgctggcaattccaaactggtctcagccatg
gcaaaggaatctgttaatgccgcatttgaactgactttagctgagggcagtcggtttgag
aaaagattgttccatgcaacctttgctacggaggacagaaaggagggcatgtctgccttt
gttgagaagagaaaggctgctttccaggacaagtaa

DBGET integrated database retrieval system