KEGG   Danio rerio (zebrafish): 369193
Entry
369193            CDS       T01004                                 

Gene name
aldocb
Definition
(RefSeq) fructose-bisphosphate aldolase C-B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00030  Pentose phosphate pathway
dre00051  Fructose and mannose metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01230  Biosynthesis of amino acids
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dre_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    369193 (aldocb)
   00030 Pentose phosphate pathway
    369193 (aldocb)
   00051 Fructose and mannose metabolism
    369193 (aldocb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    369193 (aldocb)
   03036 Chromosome and associated proteins [BR:dre03036]
    369193 (aldocb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    369193 (aldocb)
Enzymes [BR:dre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     369193 (aldocb)
Membrane trafficking [BR:dre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    369193 (aldocb)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    369193 (aldocb)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   369193 (aldocb)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 369193
NCBI-ProteinID: NP_919365
ZFIN: ZDB-GENE-030821-1
Ensembl: ENSDARG00000019702
Vega: OTTDARG00000034767
UniProt: Q8JH70 B2GP30
Position
21
AA seq 363 aa
MTHQYPALTAEQKKELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYR
QLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQ
NGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSC
PTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLAKPWPLTF
SYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKYVSSGTCGAAGQSLYVAN
HAY
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgacgcaccagtatcccgctctcaccgccgagcagaagaaggagctgcaggacatcgct
cagcgtatcgtcgctccagggaagggcatcctcgccgcagatgagtccacaggtagcatg
gccaagcgcctgaacccaatcggagtggagaacacagaggagaaccgccgtctttaccgt
caactccttttctctgctgacgagcgcattgacaagtgcatcggtggtgtcatcttcttc
cacgagaccctctatcagaacactgatgacggcacaaacttcgcccaactgatcaaggac
aggggcattgttgtgggaatcaaggttgacaaaggtgtcgttcctctggctggaacaaac
ggagagaccacaacacaggggctggatggcctgtcagaacgatgtgcccagtataagaaa
gacggcgcagactttgccaagtggcgctctgtgctgaagatcagcgacaccactccttca
gagttagccatcatggagaacgctaatgtcctggcccgctacgccagcatctgccagcag
aacggcattgtgcccattgtggagcctgagattttacctgacggtgagcacgacttgaag
cgctgccagtatgttacagaaaaggttcttgctgcctgctacaaggccctgtctgatcat
catgtgtatttggagggaactcttctgaaacccaacatggtgacagcgggacactcctgc
cccaccaaatactccagtgaggagatcgctatggcaacagtgacagccctgcgccgcacc
gttcctcccgcagtatcaggagtgactttcctctctggaggtcagagcgaggaggaggcg
tctgtcaacctgaactccatcaacaattgccctctggcaaaaccctggcccctcaccttc
tcctatggacgtgccttgcaggcctcagctctgagcgcgtggcgtggagccaagagcaat
gagaaggctgcaactgaggagttcatcaagcgcgctgaggctaacggattggctgctcag
ggcaagtacgtctccagtggaacctgcggagcagcaggacagtcgctttacgtggccaat
cacgcctactga

DBGET integrated database retrieval system