KEGG   Danio rerio (zebrafish): 373081
Entry
373081            CDS       T01004                                 

Gene name
mvp
Definition
(RefSeq) major vault protein
  KO
K17266  major vault protein
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    373081 (mvp)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373081 (mvp)
  Exosomal proteins of breast milk
   373081 (mvp)
  Exosomal proteins of bladder cancer cells
   373081 (mvp)
SSDB
Motif
Pfam: Vault MVP_shoulder Vault_2 Vault_3 Vault_4 Band_7 DUF2543
Other DBs
NCBI-GeneID: 373081
NCBI-ProteinID: NP_958482
ZFIN: ZDB-GENE-030826-33
Ensembl: ENSDARG00000021242
Vega: OTTDARG00000033673
UniProt: Q6P3L0
Position
3
AA seq 863 aa
MDADHLLGASIIRIPPHHYIHVLDQNTNIARVEIGPLTYIRQDNERVLFAPVRMMMVPPR
HYCVVLNPAVRDDEGQVQFDGSGQVKLRHADLEIRLAQDPFPLYPGEEIQKDVTPLQIVY
PDTALRLQALLDFEEEGGEKRVAGDEWLFEGPGTYIPRKEVTVLEVIKATVIRENQAIRL
RARKEGLDRSGVQRVTGEEWQVSKVGAYLPGAHEEVVDIVSAFILTDKKALHVRAIRPFR
DAGGRDRRTGEEWLVTVADREAHIPSVAEEVVGVVDVTTLNSRQYCVIMDPVGADGKPQL
GQKRVVKGERSFFLMPGEHLENGIQDVYVLSEEEGLVLRAVEAFIDTQGDEAEEEERESR
AKKRGVQRRPGDRWMLRGPIEYVPPATVEVLLTRTAIPLDENEGIYVRDIKTGKVRAVIG
QTYMLTQDEELWEKELPANVESLLAQSRDPLADRSDRGRSFGQAERDKTRVVSYRIPHNA
TVQVYDYREKKARVMFGPEMVMLGPDEQFTVLSLSGDKPKRPNVIKTICLLLGPDFCTDI
ITIETADHARLQLQLSYNWHFDLKQPADAAQAAALFSVPDFVGDACKAIASRIRGAVASV
QFDDFHKNSNRIICSAVFGFDEKLAVRSSLRFGQNGLVISSVDIQSVEPVDQRTRDALQK
SVQLAIEITTNSQEAAARHEAERLEQEARGRLERQKITDQAEAEKARKELLELEAQSAAV
ESTGAAKAEAQSRAEAARIQGEAAVEEAKLKAEAQKIEADSELARLCKAREQELNYKKQI
DHLEVEKQQKLADIESQRFKHLMDNLGTETLKEMARAGPELQVKLLQSLGLKSTLITDGS
SPINLFTTANGLLGSLQGKDKDE
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggacgctgatcacctgctcggagcctcaatcatcaggatcccacctcaccactacatc
catgtcctggatcagaacaccaatattgcacgggtggagatcggccctctcacctacata
cgtcaggacaatgagagagttctgtttgcccctgtccggatgatgatggtgccacccagg
cactactgtgttgtgctcaaccctgcggttcgtgatgatgagggccaggttcagtttgat
gggtcaggtcaggtcaagctcagacacgcagacctggagatccgcctggcccaggacccg
ttccctctctaccctggagaagagattcagaaggatgtgacgccgctgcagattgtgtat
cctgacacagcgctgcgtctgcaggccctgctggactttgaggaggagggaggagagaag
agagttgctggggacgagtggctgtttgagggaccagggacctacattcccaggaaggag
gtgaccgtactggaagtcataaaggccacggtgatcagagagaatcaggccattcgcctc
cgcgcacgtaaagagggcctggaccgcagtggagtgcaaagagttactggtgaggaatgg
caggtcagtaaggttggagcgtatctgcctggagctcatgaagaggtcgtggatattgtc
agcgctttcatccttacagacaagaaagcccttcacgtgcgagccatccgtccgttcaga
gatgctggtggtcgggatcggcgcacaggagaagagtggcttgtgacggtggccgacaga
gaggctcacattccctcagttgcagaggaggtggtcggggtggtggatgtgaccactctg
aacagcagacagtactgcgtgatcatggaccccgttggggccgatggcaaaccacaactc
ggacaaaagagagtggtgaagggtgagcgttcattcttcctcatgcccggtgagcatctg
gagaacggcattcaggatgtgtatgtgctgtcggaggaggaagggcttgtgctgcgcgcc
gtcgaggccttcattgacactcagggggacgaggcagaagaagaggaacgggaaagtcgg
gctaagaaaaggggagtacagcgccgtccaggtgaccgatggatgctgcgcggcccaatc
gagtacgtaccacctgccaccgtggaagtgctgcttacaagaaccgccatcccgctggat
gagaacgagggcatttacgttcgtgacatcaaaaccggaaaggtgcgtgctgtgattggc
cagacctacatgctgacgcaggatgaggaattgtgggagaaagagcttccggccaatgta
gagtctcttctggcgcagtcccgtgatccgctggctgaccgctcagatcgaggaaggagc
tttgggcaggcggagcgggataaaaccagagtggtgtcttatcgtatcccacacaacgcc
accgtgcaggtgtacgactacagagagaagaaagccagggtgatgtttggacctgaaatg
gtgatgctgggtcctgacgagcagtttacagtgctctccctttctggagacaaacccaaa
cgtcccaatgtcatcaaaaccatctgtctgctgctcggcccagacttctgcactgacatc
atcaccattgagacggctgatcatgcccgcctgcagctgcagctctcatacaactggcac
tttgatctgaagcagccggcggatgcggcccaggctgcggctctgttctcagtgccagac
tttgtgggcgacgcatgcaaggccatcgcttccagaatcagaggagcagttgcttccgtg
cagtttgatgacttccacaagaactccaacaggattatctgttcagctgtgtttggtttc
gatgagaagcttgcggtgcggtccagtctgcgcttcggtcagaacgggttggtcatcagc
agtgtggacattcaatctgtggagcctgtggaccagcgcacccgggatgccttgcagaag
agtgtgcagctcgccattgagatcaccactaactctcaggaggctgccgcacgacacgag
gcagagcgtctggagcaggaggctcggggtcgcctggagaggcagaagatcacagaccag
gcggaggcagagaaagcaagaaaggagctgctggagctggaggctcagagtgctgcggtg
gagagtacaggagcagcaaaagcagaggcacaatctagagccgaagcagctcgtattcaa
ggagaagcagccgtcgaagaggccaaactcaaagcagaggctcagaaaatcgaggctgac
tcagagctggcgcgtctgtgtaaggcacgcgaacaagagctgaactacaagaagcagata
gaccatctggaggtggagaagcagcagaagctggcagacatcgagagtcaacgcttcaag
catttgatggataacctgggcactgaaaccctgaaggaaatggccagagccgggcctgaa
ctacaggtgaagctcctgcagtctttgggtctgaagtctactcttattacagacggctcc
tctcccattaatctcttcaccactgccaatggcctattgggctctctgcaaggcaaagac
aaagatgaataa

DBGET integrated database retrieval system