KEGG   Danio rerio (zebrafish): 373092
Entry
373092            CDS       T01004                                 

Gene name
glud1b
Definition
(RefSeq) glutamate dehydrogenase 1b
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00220  Arginine biosynthesis
dre00250  Alanine, aspartate and glutamate metabolism
dre00471  D-Glutamine and D-glutamate metabolism
dre00910  Nitrogen metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    373092 (glud1b)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    373092 (glud1b)
   00220 Arginine biosynthesis
    373092 (glud1b)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    373092 (glud1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    373092 (glud1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    373092 (glud1b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     373092 (glud1b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   373092 (glud1b)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog Bac_GDH
Other DBs
NCBI-GeneID: 373092
NCBI-ProteinID: NP_955839
ZFIN: ZDB-GENE-030828-1
Ensembl: ENSDARG00000101074
Vega: OTTDARG00000020607
UniProt: Q6P3L9
Position
12
AA seq 542 aa
MYRYFGELLTRGAGSALASGCVESALPASSSLLRVRHYSDAADKEDDPNFFRMVEGFFDR
GATIVENKLVEDLKTRETPEQKRSRVRGILKIIKPCNHVLSVSFPIKRDNGEWEVIEGYR
AQHSQHRTPCKGGIRYSMDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPRNYSDN
ELEKITRRFTIELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYANTIAHTDINAHACVT
GKPISQGGIHGRISATGRGVFHGIENFINEASYMSKLGLTPGFADKTFIIQGFGNVGLHS
MRYLHRYGAKCVGIAEIDGSIWNPNGMDPKELEDYKLQHGTIVGFPNSQPYEGNILEAQC
DILIPAAGEKQLTRKNAHNIKAKIIAEGANGPTTPDADKIFIERNVMVIPDMYLNAGGVT
VSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKQGGPIPIVPTADFQAR
VAGASEKDIVHSGLAYTMERSARQIMRTANKYNLGLDLRTAAYVNAIEKVFKVYNEAGLT
FT
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtaccggtatttcggggagctgctgactcgcggagcgggaagcgctctggcctcggga
tgcgtcgagtccgctctgccggcttcctcgtctctgctgcgggtgcgccactacagcgat
gccgctgacaaggaggacgaccccaacttcttcaggatggtggagggcttctttgaccgc
ggcgctactattgtcgaaaacaaactggtggaggacctgaagacccgggagacgccggag
cagaagaggagccgtgtgcggggaatcctcaagatcatcaagccctgcaaccacgtcctg
agcgtgtcctttcccatcaagagagacaacggagaatgggaggttatcgagggttaccgg
gcacaacacagccagcacagaacaccctgcaaggggggtatccgatacagcatggatgtg
tctgtggatgaggttaaagctttggcttccttgatgacttacaagtgtgctgttgtagat
gtgccatttggtggagctaaagctggagtcaaaatcaaccccaggaattactctgataat
gagttggagaagatcacaagaaggttcacaattgaactggccaaaaagggattcattgga
cctggcattgatgtaccagcccctgacatgagcactggtgagagggagatgtcctggatt
gctgacacctatgctaacactattgcccatacagatatcaatgcccatgcctgtgtgacg
ggaaaacccattagccagggtggcatccacggcagaatctcagccacaggtcgtggagtc
ttccacggcattgagaacttcatcaacgaagcctcatacatgagcaaacttggcctgact
cctggatttgctgacaaaacctttattattcagggctttggtaatgtgggtctgcattcc
atgcgttatcttcaccgttatggagccaagtgtgtaggaattgctgaaatcgatggcagc
atctggaaccccaacggcatggaccccaaagagctggaagactacaaactgcaacatggc
accattgtgggcttccccaactctcagccatatgaaggaaacattctggaagctcagtgt
gatattctcatccctgcagctggagagaaacagctgaccaggaaaaatgcacacaatatc
aaagctaagattattgctgaaggtgctaatggtcccacaacacccgatgctgacaaaatc
ttcattgagaggaacgtcatggtcattccagacatgtacctgaatgccggaggtgtcaca
gtctcttactttgagtggctgaagaacctgaaccacgtcagctatggtcgcctgaccttc
aagtatgagagggactccaactaccacctgctgatgtctgtgcaagaaagtcttgaaagg
aagtttggaaagcagggtggccccatccctattgtacccactgctgatttccaggctcgt
gtagctggagcttctgagaaggacattgttcactctggtcttgcttacaccatggagagg
tcggccaggcaaattatgcgcacggccaacaagtacaacctgggcttggatctgagaaca
gcggcttacgtcaacgccattgagaaagtcttcaaggtgtacaacgaggctggtctgacc
tttacataa

DBGET integrated database retrieval system