KEGG   Danio rerio (zebrafish): 373874Help
Entry
373874            CDS       T01004                                 

Gene name
ripk2
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 2
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    373874 (ripk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    373874 (ripk2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     373874 (ripk2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   373874 (ripk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr CARD Haspin_kinase PP1_inhibitor
Motif
Other DBs
NCBI-GeneID: 373874
NCBI-ProteinID: NP_919392
ZFIN: ZDB-GENE-030902-3
Ensembl: ENSDARG00000104290
UniProt: Q4V958
Position
2
AA seq 584 aa AA seqDB search
MSRNMEHTGCVNICSLTSTLPVIPYRKLTDLHYISKGGFGTVFRAQHSDWRTTVAIKCLK
LDSPVGERERNCLLKEAEVLHKARFNHIIQIFGVCNEPEFFCIITEYMTNGSLDELLHEK
DIYPAVAWPLRLRILYEIALGVNFLHNMSPPLLHHDLKTQNILMDGEYHVKIADFGLSKW
RQLSITKGSGSKPAEMGGTVIYMPPEEYEPSKTRRTDVKYDMYSYAIIMWEVLSRRIPFE
EATNPMQIMFSVLRGARPDTGLDSLPVDIPSRETLINLMTSGWTANPDERPSFLHCLIEL
EPMLRRFDEIDVLEAVLEVKRIKYRRPSSCCSSTQSNGKKIEEKCVKELNVPWPDNSSTS
GSGSCSSQEAEISQPGFLTISTPSQGAYAGLPSSLMSLPLDPPKPLMDNCSPNNLSPEYQ
TAQVVSDLNIPFKAHAPHSESELALAIQPLTLHPHPQDFVTAFDDQGPAARWIAARREEV
VRQMTEACLNQSLDALLSRELLMREDYELVVNQTTRTAKVRKLLDTCERHSEEFCRVVVR
KLQDNKQMGLQPYPDLSTTSSPPSPYVAPSAPFLSNSFNNTRNF
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaacatggagcacaccggctgcgtcaacatctgcagtctcaccagcacatta
ccggtgatcccgtatcggaaactaacggacctgcactacatcagcaagggaggcttcggg
acggtgttcagggcgcagcacagtgactggcgcaccacagtggcgattaagtgcttgaaa
ctggattcaccggttggtgagagggaaagaaattgtttactgaaggaagctgaagtgctt
cacaaagctcgatttaaccacatcatccagatctttggggtgtgtaatgaacccgagttc
ttttgcatcataaccgagtacatgaccaacggatcgctggatgagctcctacatgagaag
gatatatacccagcggtggcttggcctttgagacttcgtatactttatgagattgctctt
ggagtcaatttcctccacaatatgtctccgccacttctacaccacgatctcaaaactcag
aacatcctgatggatggggagtaccatgttaagattgccgattttggcttgtctaaatgg
cgtcagctctcgatcaccaaaggctccggctccaaacctgctgaaatgggaggcacagtc
atctatatgccacctgaggagtacgaaccctccaaaacccgcagaaccgatgtcaagtat
gacatgtacagttacgccatcatcatgtgggaagtgctgtcgagacgaataccatttgaa
gaggccaccaatcccatgcagatcatgttcagcgttctccgaggcgctcgacctgacaca
ggcctggacagtctgccggtagacattcccagtcgagagaccctcattaaccttatgacc
agcggctggaccgccaacccagatgaacggccttcttttctccattgtcttattgaactg
gagcccatgttgagaagatttgatgagattgatgtcttggaagcagtgttggaggtcaaa
agaataaagtacaggaggccgtcaagctgctgctcatcgactcaaagtaacggaaagaaa
attgaggaaaagtgtgtgaaagagctaaatgtcccatggccagacaacagttccacatct
ggatcaggctcctgctcttcccaggaagcagaaatatcccagcctggcttccttaccata
tcaactccctctcaaggtgcttatgcgggtctgccgtcatcattaatgtctcttccactg
gatcccccaaagcctcttatggacaactgctctcccaacaacctgagtcctgaatatcag
acagcgcaggtcgtgtcagacctcaacataccattcaaagctcatgcgcctcacagtgaa
agtgagctggctcttgccatacaacccctcacactgcatccacacccacaagattttgtc
acggcgtttgacgatcaaggtccagctgcccgctggatcgctgcccgaagggaggaagta
gtgcgccagatgaccgaggcgtgtctcaatcagagtttagacgctttattgtctcgtgag
ctcctgatgcgtgaagactacgagttggtcgtgaaccaaaccacacgtaccgccaaagtg
cggaagctcctggacacatgcgagcggcacagcgaggagttctgtcgtgtggtggtgagg
aaacttcaggacaacaaacagatgggtctgcagccttacccagacctcagcaccaccagc
tcgccaccttcgccatacgtagcccccagcgcccccttcctctccaactccttcaacaac
accagaaacttctaa

DBGET integrated database retrieval system