KEGG   Danio rerio (zebrafish): 378454Help
Entry
378454            CDS       T01004                                 

Gene name
aaas
Definition
(RefSeq) aladin
  KO
K14320  aladin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    378454 (aaas)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    378454 (aaas)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     378454 (aaas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 378454
NCBI-ProteinID: NP_998390
ZFIN: ZDB-GENE-030912-4
Ensembl: ENSDARG00000102274
Vega: OTTDARG00000032143
UniProt: Q6NW98
Position
9
AA seq 499 aa AA seqDB search
MCSLAVFPPPLAAGHTHTLMEQHNELQASDPQVDLPSPQFTRDTLKGHSRAESSSKSAFL
DQRDTLWRRSAGAWRDAGLYGLLDQITNSADEVPRCVSVGSSCLLALLRWSSSFHGSLFP
HLTLSSDEMVAEFSQMLDWSDSAVRSFSWHPHTDKFAVALLDDSIKIYKPHSSTAPTLKH
RCQRSVCALQWKPLCGSALAVACQSCLLIWHVDPASLSTRPSSGCAQVLSHPGHSPITSI
AWSPTGSLLVSASPVDTAMMVWDVAAESCVPLRRVGGGGVTFLSWSPDGSRLLAATPSAL
FRVWETRMWTCERWPCLKGSCQSACWSPDGACLLLSIQGERLIYALSFSDLTGGPKAATV
VADLSETSFPGPEGDLTVGGEVCSLSWDPRGERLAVLLKGDAQSTDHPSVIAVFKTRCSP
AFELLPCGFVMGEAGAEPRFMQFHPHFQHGALLTVCWSDGRITHVPFYFSSAGLSDSQRP
AALSTADRSISRLYTEDLH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctctggctgtgtttcctcctccgctggctgcgggacacacacacacactgatg
gagcagcacaacgagctgcaggcgtctgaccctcaggtcgatctgcccagtcctcagttc
accagagacacactgaagggtcacagtcgagccgagagcagcagtaaatcagcattcctg
gaccagagagacacactgtggaggagaagcgctggagcctggcgtgatgctggtctgtac
ggccttctggaccagatcaccaacagtgcagatgaagtgcccaggtgtgtgtcggtgggc
tcctcctgtctgctggctctgctgagatggtcttcctccttccatggctctctgtttcct
catctgacactcagcagtgatgagatggtggccgagttctcccagatgttggactggtca
gacagtgctgtgcggagcttctcttggcatcctcacacggataagtttgctgtagcgctg
ctggacgactccatcaagatctacaaaccgcacagctcgacggcccccacactgaagcac
cgctgtcagaggagtgtgtgtgcgctacagtggaagcctctgtgcggatcggctctggct
gtggcctgtcagtcctgcctgctcatctggcatgtggaccctgcgtctctgtccaccagg
ccgtcgtcaggctgtgcgcaggtcttgtctcaccccggtcactctcccatcacctccatc
gcctggtcacccaccggctccctgctggtgtctgcgtctcctgtcgacacggccatgatg
gtgtgggacgtggcggcggagagctgtgtgccgctgcggagggttggcggcggtggcgtc
acgttcctctcctggtctccagatggcagtcgactgctggccgccacaccgtctgctctc
ttcagggtttgggagacgcgtatgtggacgtgtgagagatggccgtgtctgaaaggcagt
tgtcagtcagcgtgctggagtccagacggagcctgtctgctgttgagtattcagggagag
aggctgatctacgcgctctccttctctgatctcacaggaggtccgaaagccgctacagtg
gtggccgatctgtctgagaccagctttcctggacctgaaggagatctgactgtcggagga
gaggtctgctctctgtcttgggatcctcgaggtgaaagactcgctgtgctgctgaaagga
gatgcgcagtccactgatcatccttcagtcatcgccgtgtttaagacgcgctgcagtcct
gcatttgagctgctgccgtgtgggtttgtgatgggcgaagctggagccgaacccagattc
atgcagttccacccgcacttccagcacggcgctctgctgacggtgtgctggtctgacggc
agaatcacacacgtgccattttacttcagcagtgctggactctcagactcacagcggccg
gcggctctgagcactgctgaccgctccatcagcagactctacactgaagatctacactga

DBGET integrated database retrieval system