KEGG   Danio rerio (zebrafish): 378960Help
Entry
378960            CDS       T01004                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00561  Glycerolipid metabolism
dre01100  Metabolic pathways
Module
dre_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    378960 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dre01002]
    378960 (mgll)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     378960 (mgll)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S33
   378960 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Lipase_3 Abhydrolase_2 Peptidase_S9 LIDHydrolase PGAP1 Chlorophyllase2 Abhydrolase_5 PAF-AH_p_II Abhydrolase_3 DUF1350 Ser_hydrolase DUF1057
Motif
Other DBs
NCBI-GeneID: 378960
NCBI-ProteinID: NP_956591
ZFIN: ZDB-GENE-031006-9
Ensembl: ENSDARG00000036820
Vega: OTTDARG00000020271
UniProt: Q7ZWC2
Position
8
AA seq 300 aa AA seqDB search
MPEPEGTRRSPQGVPYSDLPHIVNADGLHLFCRYWEPDGPPKALVYVAHGAGEHCGGYAD
IAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKARYPKLAVFIVG
HSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPID
PKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDATSRIERELPDIRWPFYILHGDADK
LCDIRGSRLLYNEAKSTDKKLKVYEEAYHALHHDLPETIESVLKEVSTWILERVPAPQTS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccgaggggactcgtcggtcaccgcaaggtgttccttacagcgacctgccg
cacatcgtcaacgccgacggactgcacttgttctgtcgttactgggagcccgacggtcct
ccgaaggcgctggtgtatgttgcccatggagcgggagagcattgtgggggatacgctgac
attgctcacagtctgacccagcatggcattctggtgttcgcccacgaccacgttggtcat
ggtcaaagtgaaggtgagaggatggagctcaaaaacttccagatttacgtcagagactcc
ctccagcacattgacatcatgaaggctcggtatcccaagctggccgtcttcatcgttgga
cattcaatgggaggagccatttccattctgaccgcatgcgagaggccgcaggattttaca
ggtgtggttctcattggccctatggttcagatgagtgctgaatctgctacacccttcaag
gttttcatggccaaagttctaaaccgcttggctcctaaactcactctcggcccaatcgat
ccaaaatttgtctcacgggatcccaaacaggtggaggcatatgaaaaggatgagctgaat
tatcatggggggctacgcgtctcgttcgggatgcagatgttggatgcgacgtctcgcatc
gagagagagttaccagacatcaggtggcccttttacattctacatggagacgccgacaaa
ctgtgtgacatcagaggctctcgattattgtataatgaagccaagagcactgataaaaaa
ctgaaggtatatgaagaagcttaccatgccctacatcacgacttacctgaaacaatcgag
tctgtattaaaggaggtgagcacctggatcctggagagagtccctgcccctcaaacctct
tag

DBGET integrated database retrieval system