KEGG   Danio rerio (zebrafish): 378964Help
Entry
378964            CDS       T01004                                 

Gene name
emx1
Definition
(RefSeq) homeobox protein EMX1
  KO
K09317  homeobox protein EMX
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    378964 (emx1)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Ems
    378964 (emx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 378964
NCBI-ProteinID: NP_937787
ZFIN: ZDB-GENE-031007-7
Ensembl: ENSDARG00000039569
Vega: OTTDARG00000020759
UniProt: Q804S6 A3KNV6
Position
13
AA seq 231 aa AA seqDB search
MFSATGKRCFTIESLVAKESPITLEDPIRPTALSYSAPADSFLNGYQSPAGRALYPNPEL
VFSETVNHAPLSMHPHQLGSAPLQHPHFFGTQHREPLNFYPWVLRNRFFGHRFQGNDVSQ
DTLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANSLSLSETQVKVW
FQNRRTKYKRQKLEEEGPECTQKKKGNHHINRWRIATKQTGSEDIDVMSDA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggcaacggggaagcgctgttttaccattgagtctctggtggcgaaggaaagc
cccattacactagaagaccctattcgcccaaccgctctaagctactcggcgcccgctgac
agttttcttaacgggtaccaaagccccgcaggccgcgcgctctatccaaaccccgagctg
gtgttttcggagactgtgaaccatgcacctctcagcatgcacccacaccagctcggcagc
gcacccctccagcacccgcacttctttggcacgcaacatcgtgaaccactgaatttctac
ccttgggtcctaaggaacaggttttttggacatcggtttcaaggtaatgatgtctcccag
gacacgctgctactacacggaccgttcgcgaggaagcctaaacggattcgcaccgcattc
tcgccgtctcagctgctgcgcctggaacgcgccttcgagaaaaaccattatgttgtcgga
gcggaacggaaacagctcgcaaacagcctcagtttatccgagactcaggtgaaagtttgg
ttccagaaccgcaggaccaagtataagcggcagaagctggaggaagaaggcccggagtgc
acacaaaagaagaaaggaaaccaccacattaaccgctggaggattgccaccaaacagacc
ggatctgaggacatagatgtcatgtctgatgcttaa

DBGET integrated database retrieval system