KEGG   Danio rerio (zebrafish): 378990
Entry
378990            CDS       T01004                                 

Gene name
nudt4a
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 4a isoform 1
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    378990 (nudt4a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     378990 (nudt4a)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 378990
NCBI-ProteinID: NP_001296990
ZFIN: ZDB-GENE-031010-33
Ensembl: ENSDARG00000057767
Vega: OTTDARG00000014765
UniProt: Q1L8L1
Position
18
AA seq 226 aa
MISLGNLGRLSALGLKGSCVARRIQKLGNREHLYSCFVRRKTHMMKFKPNQTRTYDGEGF
KKRAACLCFKNDREDEVLLVSSSRHPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVRGTL
GRLLGVFEQNQDSKHRTYVYVLTVTETLEDWEDSVNIGRKRKWFKIDEAIRVLQCHKPFH
AEYLRKLTPRCGPTNGNTQEPTMNTDDNASLRQTASHDCGLTRLHR
NT seq 681 nt   +upstreamnt  +downstreamnt
atgatcagcctgggaaatctgggacgactttcagctcttggcctgaaaggcagctgcgtt
gcgcgtcggatccaaaaactaggcaaccgagaacacttgtattcttgttttgttcggaga
aaaacccacatgatgaaattcaagcccaatcagacaaggacgtatgacggagagggcttc
aaaaaacgagcagcctgcctgtgcttcaagaacgaccgagaggacgaggttttgctggtt
agcagcagtcgacacccagatcagtggatcgttcctggaggagggatggagccggaagag
gagcctggaggagctgcggtccgagaggtttatgaagaggctggagtgaggggcaccctt
ggcaggctactgggggtgtttgagcagaaccaggacagcaagcatcgaacctatgtgtat
gtgcttactgttacagagacactggaagactgggaggactcagtcaatattggtcgcaaa
cggaaatggttcaagattgacgaggccatccgggtgctacagtgccacaaaccattccac
gcagaatatcttcgcaaactcactcctcgctgcggccccacaaacggcaacacccaggag
ccgacgatgaacacagacgacaacgccagcctccgccagacggcctcacacgactgcgga
ctgacccgcttgcacagatag

DBGET integrated database retrieval system