KEGG   Danio rerio (zebrafish): 386920
Entry
386920            CDS       T01004                                 

Symbol
hist2h2l
Name
(RefSeq) histone H2B 3
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    386920 (hist2h2l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    386920 (hist2h2l)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    386920 (hist2h2l)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   386920 (hist2h2l)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 386920
NCBI-ProteinID: NP_956411
ZFIN: ZDB-GENE-031118-36
Ensembl: ENSDARG00000068996
Vega: OTTDARG00000008399
UniProt: Q6PC60
Position
10
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgaacctgcgaagtcagcgcccgctcccaaaaaaggctctaaaaaagctgtcacc
aagacccagaagaagggggataagaaaaggcgtaagaccaggaaagagagttacgccatt
tacgtgtacaaagtactaaaacaagtccacccggacactggcatctcctcaaaggcgatg
ggcattatgaactcatttgtaaacgacatcttcgagcgcatcgccggagaagcgtcgcgc
ctggcgcattacaacaagcgctccactatcacatcccgggagatccagacggccgtgcgc
ctgctcctgcccggggaactggccaaacacgcagtgtctgagggcacaaaggccgtgacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system