KEGG   Danio rerio (zebrafish): 387000
Entry
387000            CDS       T01004                                 

Gene name
slc25a37
Definition
(RefSeq) mitoferrin-1
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    387000 (slc25a37)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    387000 (slc25a37)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    387000 (slc25a37)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   387000 (slc25a37)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 387000
NCBI-ProteinID: NP_001035060
ZFIN: ZDB-GENE-031118-202
Ensembl: ENSDARG00000073743
Vega: OTTDARG00000034559
UniProt: Q287T7 B3DKD7
Position
8
AA seq 332 aa
MELRTDAVLASLEMSEPVKNDEDYESLPAHASLGTHMTAGAVAGILEHTVMYPVDSVKTR
MQSLQPDPKAQYRSVYGALKRIVRTEGLLRPLRGLNITVLGAGPAHALYFACYERIKRSL
SDVIQNGGNSHIANGVAGSVATVLHDAVMNPAEVVKQRMQMYNSPYRSLYDCVLMVSRKE
GLAAFYRSYSTQLTMNIPFQAVHFITYEFMQEHFNPHRQYRPETHIISGAAAGAVSAAVT
TPLDVCKTLLNTQENVALSSAHVSGHLSGMVNALRTVYRLGGVPAFFKGIQARVIYQMPS
TAIAWSVYEFFKYFLTQHESHVQEVSHKTSPT
NT seq 999 nt   +upstreamnt  +downstreamnt
atggagttgcgcaccgacgcggtattggccagcctggagatgtcggagccggtgaaaaat
gacgaggattacgagagtttgcccgctcatgcctccctgggcacgcacatgacagcagga
gccgtggccggaatactggagcacacagtcatgtaccccgtggattcagtcaagacacga
atgcagagtttacagccggacccgaaggctcagtaccgcagtgtgtacggtgcgctgaag
cggatcgtgcggacggagggtctccttcgacccttgaggggcctcaatatcactgttttg
ggggccggtccagcacacgctctctatttcgcctgctacgagcgaatcaagcgtagcctt
agtgacgtcattcaaaatggaggcaacagccacatagctaacggtgtggcagggagtgtc
gctactgtcctccatgatgcagtcatgaacccagctgaagtggtgaagcagcggatgcag
atgtacaactctccataccgcagcctgtacgactgcgtgctgatggtcagccgtaaagaa
ggactggctgctttctaccgcagctacagcactcagctcaccatgaacatccccttccag
gccgttcatttcatcacctatgaattcatgcaggaacacttcaacccccatcgccagtac
cggcccgaaacgcacatcatatccggagctgcagcaggagccgtgtctgctgcagtcacc
actccgctggacgtctgcaaaacgctgctgaacacgcaggaaaacgtggctctgagctcc
gcacatgttagcggccatctctcaggcatggtgaacgcactcaggacggtttaccgacta
ggaggcgtacccgcgtttttcaaaggcatccaggccagagtcatctatcagatgccgtct
acagccatcgcctggtccgtctatgagttcttcaagtactttctgactcaacacgagtcg
cacgttcaggaagtttcccacaaaaccagccctacatga

DBGET integrated database retrieval system