KEGG   Danio rerio (zebrafish): 393124
Entry
393124            CDS       T01004                                 

Gene name
uso1
Definition
(RefSeq) general vesicular transport factor p115
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Uso1_p115_head Arm_vescicular Uso1_p115_C DUF4407 Crescentin TSC22 Filament Seryl_tRNA_N
Other DBs
NCBI-GeneID: 393124
NCBI-ProteinID: NP_956449
ZFIN: ZDB-GENE-040426-688
Ensembl: ENSDARG00000019581
Vega: OTTDARG00000030172
UniProt: Q7ZW40
Position
1
AA seq 956 aa
MDFLRGVMGSKPAGPQPTGAETIQKLCDRVASSTLLEDRRDAVRALKSLSKKYRLEVGTM
SMDHLVRILQTDRSDTEILGYALDTLYNIVCNDEEEEQDDSEEENQQKQEDDLGAQFTDK
FIQEPENITLLLTLLEEFDFHVRWPGVKLLTALLKSQCAQVQGIVLVSPMGVSRLMDLLA
DSREVIRNDGLLLLQQLTKGNAAIQKIVAFENAFERLLDIITEEGSSDGGIVVEDCLLLL
LNLLKNNSSNQNFFKEGSYIQKMKPWFEVGDDNSGWSAQKVTNLHLMLQLVRVLVSPVNS
PGATASCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGSEVNQDYFASVNA
PSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVATLLPSTIDANS
ISAGQLLCGGLFSADSLSNWCAAVALAHALQDNLTQKEQLLRVQLATSLGKPPVSLLQQC
TNILSQGDKLNRRGSRVQTKVGLLMLLCTWISNCPIAVMHFLHNQDNVPFLTGQISENLG
EDERLVQGLCALLLGICIYYNDNSLENYTKEKLKQLIEKRIGKENFVEKLAFITKHELYS
RAAQKPQPAFSTPEHMLFDHEFTKLVKELEGMITKAVLRSSEEEKKEEEVKKTLEQHDSI
VTQYKELIREQDSQINELKKQVTALTSQTENLESTITQQLSQIQQHKDQYNILKLKLGKD
TQQAGNQAEAAHVNGLQPEELSQLRERLEEVQRQNQLLQTQLTEKDSLITSLKAEGVPSV
EDSTSEVTELRKEVEGLKAQLQSQTAEITQLQNERQELLRGSEPTVAVPAEESVYKEKIA
ELESRLSAQTTENQKLKGEVKTLLESKESMEKDLASATSTSAILQAEKNKLQQEVQESKK
EQDDLLMLLADQDQKILNLKQRLKDLGEPIEDEDELDSRDQFEDDDEEEEEEECDE
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggatttcctgaggggagtaatgggaagcaaaccagcaggcccgcagccgactggagca
gaaacaattcagaagctgtgtgatcgtgtggcttcatcaaccctgttggaggatcgaaga
gatgctgttcgtgccctaaaatccctgtccaagaaatatcgtctggaggttgggacaatg
tcaatggaccatttggttcgtatactgcaaactgaccggtcagacactgaaatcctaggt
tatgctttggacactttgtacaacattgtttgcaacgatgaagaagaggaacaagatgat
tctgaagaagagaaccaacagaagcaggaggatgatttgggagctcagttcactgacaag
ttcattcaggagccagaaaacatcactcttcttcttacactgttggaggagtttgacttc
catgttcgctggccaggtgtgaagcttttaactgcacttttgaaaagccagtgtgctcaa
gtccagggcatcgtcctggtcagcccaatgggagtatccaggttaatggatcttcttgct
gactccagagaagttatacgtaatgatggtctccttttactgcagcagcttaccaaaggg
aatgctgcaattcagaaaattgtggcttttgaaaatgcatttgagaggcttcttgatatt
atcactgaggagggttcaagtgatggaggtattgtggtggaggactgtctactgttgttg
ctaaacctgctgaagaacaacagctccaaccagaattttttcaaggaaggctcttatatc
caaaagatgaagccgtggtttgaggtgggggatgacaactctggctggtcggcacagaaa
gtcaccaacctccatctaatgctgcagctggtgcgagtgttggtctctccagtgaactct
ccaggggccacagccagctgtcagaaggccatgttccagtgtggtctcctccagcagctc
tgcaccatccttatggccacaggagttcctgcagacatcctcacagagaccatcaatact
gtgtcagaggtcatacgaggctctgaagtgaatcaggactactttgcatctgttaatgca
ccatctaacccaccaaggcctgcaattgtggtccttctcatgtccatggtgaatgagaga
cagccgtttgttctccgctgtgctgtactttactgttttcagtgctttctttataagaat
caaaaaggacagggggagattgttgccacactgctgccctccactattgatgcaaactct
atctcagcaggccagttgttgtgtggaggtctgttctctgcagactctctgtcaaactgg
tgtgccgctgttgctttggctcatgcactgcaggataatctcacccagaaagagcagcta
ctgcgggtacagttggccaccagtctgggcaaaccaccggtttctcttcttcagcagtgc
actaacatcctctcccagggtgataagctcaaccgaaggggcagtagggtgcagacgaag
gtcggtctcctcatgttgctctgcacctggatcagtaactgtccaatcgctgtcatgcac
ttcctgcacaatcaagacaatgttccctttttgacaggacaaatctcagaaaatctgggt
gaggatgagcgactggttcagggtctctgtgctctgttgttggggatttgtatctactat
aacgacaacagtttagagaactacactaaagaaaagctgaagcagttgattgagaagcgc
ataggaaaggaaaactttgtggagaaattggcctttataacgaaacacgaattatattcc
cgggcggctcagaaacctcagccagccttttccacaccagaacacatgctgtttgatcat
gaatttaccaaacttgtcaaagagttggaaggtatgataacaaaagcagtgctaaggtca
agcgaagaagagaaaaaggaggaagaggttaagaaaacactagagcaacatgacagcatt
gtaacccaatacaaagagttgatcagagaacaggattctcagataaacgagctgaaaaaa
caagtgaccgctcttacatcccagactgaaaatttggagagcaccataacacaacagctt
tctcagatccagcagcacaaagatcagtacaacatcctcaaacttaaactaggtaaagat
acgcagcaggcaggtaatcaggcggaggcagctcatgtcaatggcctccagccagaagag
ctaagtcagctcagagaacgactcgaggaagtgcaaagacaaaaccagctattgcagaca
caactgactgagaaggactctctaataaccagcctgaaagctgagggtgtgccatcggta
gaggattcaacatcagaggtcacagaattacgaaaggaggtagaggggctgaaagctcag
ctgcagagccagactgcggagatcacacaactgcagaatgaaagacaggagcttctccga
ggatctgagcccacagttgcggtcccagcagaagaaagcgtctataaagagaagattgca
gagttggagagcagactgtctgctcagacaacagagaaccagaagctcaagggtgaagtt
aaaactcttctggagagtaaagaatcgatggagaaagaccttgcttcggccacaagcaca
tccgccatcttgcaggcagagaaaaacaagttacagcaggaggtgcaggagtccaaaaaa
gaacaagatgatcttctcatgctccttgctgaccaggaccagaagattttgaacctcaaa
cagagactcaaagacttgggagagccgattgaagatgaggatgaactggattcaagagac
cagtttgaggatgacgatgaagaagaggaggaagaagagtgtgatgaataa

DBGET integrated database retrieval system