KEGG   Danio rerio (zebrafish): 393133Help
Entry
393133            CDS       T01004                                 

Gene name
slc25a14
Definition
(RefSeq) brain mitochondrial carrier protein 1
  KO
K15106  solute carrier family 25 (mitochondrial carrier), member 14/30
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    393133 (slc25a14)
Transporters [BR:dre02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   393133 (slc25a14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr TRAPP
Motif
Other DBs
NCBI-GeneID: 393133
NCBI-ProteinID: NP_956458
ZFIN: ZDB-GENE-040426-749
Ensembl: ENSDARG00000026680
Vega: OTTDARG00000021099
UniProt: Q7ZVV6
Position
21
AA seq 286 aa AA seqDB search
MANLNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREE
GVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSL
ANPTDVLKIRMQAQGSLLQGSMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVY
DITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGT
LDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKLPL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctgaactggaagccgtttgtctatgggggaatggcctcaattgtcgcagaa
tttggtacgttccccattgatctcacaaaaacgcggcttcaggttcaagggcagacgcac
tgtatggaggttcgataccgtgggatgttccatgctttgttaaggattggacgagaggaa
ggcgtccgggcattgtactccggaatttcacctgcccttctccgacaagcttcttatggc
acgatcaagatcggtacatacaacacactaaagaaactgtttgtcagccatccagaagaa
gagacgatggtgattaatgtgttttgtggtgtggtgtcaggagttttgtcttcctctttg
gcaaatccaactgatgtgctgaagattcgcatgcaggctcagggcagtctgttacagggc
agtatgatgtccaacttcatgaacatctaccagacggagggcacacgaggcctgtggagg
ggtgttattcctactgcacagagggcagccatcgtggtcggtgtggagctgccagtctat
gacatcaccaagaaacatctgatccgttcaggcctcatgggagacacggtgttaactcat
ttcatttccagtttcacgtgtggcctggcaggcgctctggcctctaatccggtggatgtg
gtgaggacgcggatgatgaatcagcgtgtgctcgccggtaaccctctgtacaagggcacg
ctggacggactcatgcagacctggagaaatgaaggctttttcgctctctataaaggcttc
tggcctaactggctgcgtctggggccgtggaacatcatcttcttcatgaccttcgagcag
ctgaagaagcttccattgtag

DBGET integrated database retrieval system