KEGG   Danio rerio (zebrafish): 393175
Entry
393175            CDS       T01004                                 

Gene name
erap1b
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1b precursor
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    393175 (erap1b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     393175 (erap1b)
Peptidases and inhibitors [BR:dre01002]
 Metallo peptidases
  Family M1
   393175 (erap1b)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 393175
NCBI-ProteinID: NP_956500
ZFIN: ZDB-GENE-040426-934
Ensembl: ENSDARG00000021859
Vega: OTTDARG00000016561
Position
5
AA seq 963 aa
MATMTRLPVLLNLIVLPIHLWAAVTPEPTSFPISSSGEPFPWNKMRLPDTISPLHYNLLI
HPNLTSLDFTGSVQIQIEVLQDTKTIILHSKNLQISSARLLDANIAQQQPLKVLEYPYFQ
QIALVSDKALLKRGHVYSVELHFAANLSESFHGFYKSTYRTSKGDVRVVASTQFEATSAR
AAFPCFDEPAFKANFSVQIRREAKHIALSNMPKLRTLELKNGLFEDQFDVSVKMSTYLVA
YIVSDFLSISKTSQHGVQISVYAVPEKIDQAEFALDAAVKLLDFYDDYFDIPYPLPKQEK
PTIKHAKEEFSVYIICFVDLAAIPDFQSGAMENWGLTTYRESALLFDPHKSSASDKLGIT
MIIAHELAHQWFGNLVTMQWWNDLWLNEGFAKFMEFVSVNITNPELQVEDYFLGKCFEAM
EVDSLSSSHPVSTPVENPAQIQEMFDDVSYDKGACILNMLREFLTPKIFKLGIVKYLKHY
SYQNTVNSNLWESLTNVCDSDGLDEGRLKGDESCRHSASNTGASKWHSEDELDVKAMMET
WTLQEGFPLITIAVKGREVRLSQERYLKSDDLSQTSSFLWQVPLTYITSDSTTVHRFLLK
TKTDVLYLPEEVDWIKFNVDMSGYYIVHYEGSGWDDLITLLKHNHTALSSNDRASLINNA
FQLVSVGKLPLDKALDLTLYLSKETEIMPVTQGFNELVPLYKLMEKRDMVELENQMKGYI
LQLFQKLIEQQLWTDEGSVSERMLRSYLLLFGCVRGHPPCVSNATQLFNLWRDSDGNMSL
PNDVTMAVFSVGARTEDGWDFLFEKYKESMYVSMKSRIKQALMTSPLDHKLKWMMEQSLE
GELIKTQDLPYVVTSVSRNPKAYKHAWDFLQANWDSLIKKFDLGSHSIAHMVVGVTNQYS
TREMLAEVRNFFSLLQPETGAELRCIQQAVENIEENIRWMDKNLPLLKAWLHRYYDQQKN
TEL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcaaccatgactcgccttcctgtgctattgaacctcatagttctgcctattcacctt
tgggctgctgtcactccagagcccacttcatttcccatttcaagcagtggagagccattc
ccatggaacaaaatgagacttccagacacgatatctccccttcattacaatctccttatc
catcctaacctcacaagtttagattttactggatcagtacagattcaaattgaggtgctt
caagacaccaagactatcatattgcacagcaagaatcttcaaatctcaagtgcaagactg
ttagatgcaaatatagctcagcagcagcccctaaaggtgctagagtacccatacttccag
cagattgcacttgtatctgataaagcactgttaaagagaggccatgtatactcagtagaa
ctgcattttgctgccaacctctctgagagctttcatggattttacaaaagcacataccgc
accagtaaaggagatgtcagggttgtggcttccacacagtttgaggcgaccagtgcccgt
gccgcctttccctgttttgatgaacctgccttcaaagcaaacttttcagtgcagattcgc
agagaagcaaaacacattgccctctctaatatgcctaagctgagaacattggagctgaaa
aacggcctgtttgaggatcagtttgatgtgagcgtaaaaatgagcacatacctggtggcc
tacattgtctctgactttctctctatcagcaagacaagtcagcatggagtccagatttca
gtgtatgctgtgccagagaagattgaccaggccgagtttgctctggatgctgcagtgaag
ttgcttgacttctatgatgactactttgacataccttaccctcttcccaaacaggaaaaa
ccaaccattaaacatgcaaaggaggaattcagtgtttatataatctgctttgtagatctc
gccgccatcccagactttcagtctggagcgatggagaactggggtctgaccacttatcgg
gaatctgcccttctttttgacccgcacaagtcttctgcttctgacaagcttggaatcaca
atgatcatcgctcatgaactggcccatcagtggtttggtaatctggtgaccatgcagtgg
tggaatgatctgtggctgaacgaaggttttgccaagttcatggagtttgtgtctgttaac
atcaccaatcctgaactgcaagttgaggattatttcctaggaaagtgtttcgaggccatg
gaagtagactctttaagctcttctcatccagtgtccacaccagtggagaaccctgctcag
atacaggaaatgttcgatgatgtttcctatgacaagggggcttgtattctgaacatgctg
agagagtttctgaccccaaagatatttaagttgggcattgtgaagtatctaaaacactac
agctaccagaacacagtcaatagtaacctgtgggaaagtctgaccaatgtttgtgattcc
gatggtctggatgagggccgactgaagggtgatgagtcctgtcggcattcagcctcaaac
actggagcttctaaatggcactctgaggatgagctggatgttaaggctatgatggagacg
tggacattgcaggagggctttcctctcattaccatagctgtcaaagggcgggaagtcagg
ctgagtcaagaacgttacctcaagagtgacgacctatcacaaacatccagcttcctgtgg
caggtgccattgacttatattaccagtgactcaacaacagtgcaccgctttctgctaaag
accaaaacagatgtgctgtatctgccggaggaggtggactggatcaagtttaatgtggac
atgagtggatattacattgtgcactatgagggctcaggctgggatgacctcattacgctg
ctcaaacacaatcacactgcgctcagcagcaacgaccgtgccagtctgatcaacaacgcc
ttccagctggtcagtgttggcaaacttcctctggataaggctttggatctgaccttgtat
ttaagcaaagaaacagagataatgccagtgactcagggcttcaatgagcttgtgcctctc
tacaaactgatggagaagagagacatggtggagctggagaaccagatgaagggctacatc
ctgcagctgttccagaagctgatcgagcagcagttgtggacagatgaaggctctgtgtct
gagaggatgctgcgcagttacctgctgctgttcggctgtgtgcgcggacatccaccctgc
gtcagcaacgccacacagctcttcaacctctggagggactcggatggaaacatgagtctt
cctaatgacgttactatggctgtgttttctgttggcgcccggactgaggatggctgggat
ttcctgtttgagaagtacaaggagtccatgtacgtctcgatgaagagcagaattaagcag
gcgctcatgaccagcccactcgatcacaagctcaaatggatgatggagcagagtttggaa
ggagagctgatcaagactcaggatctgccgtatgtggtgacctcagtcagtagaaatccc
aaagcatacaaacatgcatgggactttttacaagctaactgggactccctgattaagaag
tttgacctcggctcacactctatagcgcacatggtagtaggagtgaccaaccagtattcg
accagagaaatgctggctgaggttcgtaatttcttcagtttgctgcagcctgagactgga
gcagaactgaggtgcattcagcaggccgtggagaacattgaagagaacattcgctggatg
gacaagaacttgccgctgctgaaggcctggctgcacagatactatgaccagcaaaaaaat
acagagctgtga

DBGET integrated database retrieval system