KEGG   Danio rerio (zebrafish): 393287Help
Entry
393287            CDS       T01004                                 

Gene name
chuk
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04623  Cytosolic DNA-sensing pathway
dre04625  C-type lectin receptor signaling pathway
dre04920  Adipocytokine signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393287 (chuk)
   04068 FoxO signaling pathway
    393287 (chuk)
   04150 mTOR signaling pathway
    393287 (chuk)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    393287 (chuk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    393287 (chuk)
   04621 NOD-like receptor signaling pathway
    393287 (chuk)
   04622 RIG-I-like receptor signaling pathway
    393287 (chuk)
   04623 Cytosolic DNA-sensing pathway
    393287 (chuk)
   04625 C-type lectin receptor signaling pathway
    393287 (chuk)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    393287 (chuk)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    393287 (chuk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    393287 (chuk)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     393287 (chuk)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   393287 (chuk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IKBKB_SDD Pkinase Pkinase_Tyr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD Kinase-like PhoU_div YrbL-PhoP_reg DUF3887
Motif
Other DBs
NCBI-GeneID: 393287
NCBI-ProteinID: NP_956611
ZFIN: ZDB-GENE-040426-1069
Ensembl: ENSDARG00000011662
Vega: OTTDARG00000018245
UniProt: Q4G3H4
Position
13
AA seq 758 aa AA seqDB search
MEKPPFRQNQVCGSWVMKERLGTGGFGHVYLYQNQETSEKIAVKLCRLELNSKNKDRWSR
EIQIMKKLKHLNVVTAKDVPEEMMHIALNDLPLLAMEYCSKGDLRKLLSKPENCCGLKES
EVLSLLNDVGSGIQYLHENKIIHRDLKPENIVLQEINGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFEGKSYTVTVDFWSFGTMIFECCCGFRPFLHNLQPVQWTSKVRNKGP
KDIMAVEDMNGEVRFSTHLPYPNNLSRTLLEPLEGLLQLMLKWDPVQRGLGLNTDSKQPQ
CFVLLDQILSMKVVHILNMTTTQVHSFLLSPDEGLHSLQQRIENETKIELLNQDLLQETG
VMLDPRKPAAQCVLDGVRGWDSYIVYLFDKSLTKYMGPLTARTLPESVNFIVRETKTQLP
LSTLKKVWGEAVSYICGPREDYSRLFQGQRAAMLSLLRFNTNLTRYKNMMFSFSQQLKAK
LDFFKTSIQYDLEKYSDQMQYGISSEKMLKAWHENEERAAAFAQVAEIGHLDEEIMALHS
EIVELQRSPYARRQGDVMEQLQEKAIELYKQLKAKCKMPDPQHGYSDSSEMVKVIVQTVQ
NQDRVLRDLYAHLSKIPLSKQKIIDLFPKIERTLECIKEADTTVMQMQIKRQREFWHLLK
IACAQNTTRSSVSQSGEMPSSLSTWNQTQAQCSSRLPMSLQVPHEGDSVNHLLEENQRYL
TQLTSLLQETTEEKSESIMAQDWSWTKYESLVAKSARL
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaccccctttcagacagaatcaggtctgtggctcatgggttatgaaggagagg
cttggaacaggaggatttggccatgtctatttgtatcagaatcaggaaacatcagaaaaa
atagctgtgaagctctgtcgccttgagcttaattcaaaaaacaaagacagatggagtcga
gagatccagattatgaaaaagctaaagcaccttaatgtggtcacagcaaaggatgtgcct
gaggagatgatgcacattgccttgaatgatttaccacttttagccatggagtattgttcc
aaaggagatcttcgtaagttgttgagcaaacctgaaaattgctgtgggttgaaagagagt
gaggtgttgtctctactcaatgatgttggttctggaatccagtaccttcatgagaataag
atcatacacagggatctcaagccagagaatattgtgctgcaagaaattaatggaaagctt
gttcacaagataatcgaccttggttatgccaaagacctggaccaggggagcttatgcact
tcatttgtggggactttacaatatctggctccagagctttttgaaggcaagtcctacaca
gtcactgtggacttttggagctttggcaccatgatctttgaatgctgctgtggatttcgt
ccatttcttcacaatcttcagcctgtgcagtggacaagcaaagtgcgaaataaaggtccg
aaggatataatggctgtggaagatatgaatggcgaggtccgcttttccacccaccttcca
tacccaaacaatcttagcaggacactactggagcccttggaaggccttttacagctgatg
ctcaaatgggaccctgtacagagaggattaggactgaacacagattcaaaacagccccag
tgctttgttcttctagatcaaatactgagcatgaaggttgtgcacatcttgaacatgact
acgacccaggttcactcatttttgctaagcccagatgaagggcttcactctctgcaacag
aggattgagaacgaaaccaaaattgaacttttgaatcaagatcttctgcaagaaacagga
gtcatgttagatcccaggaaacctgctgcacagtgtgtgttagatggagtaagaggatgg
gacagctacattgtatatctgtttgacaagagtttgaccaagtacatgggacctttaact
gctagaacacttcccgaaagtgtcaactttattgttcgggaaaccaaaactcagctccca
ctgagtaccctaaaaaaggtttggggtgaggcggttagctacatttgtggccccagagaa
gactacagccgcctcttccagggccagcgtgcagccatgctgagtcttcttcgcttcaat
acaaatttgacaagatacaagaacatgatgttctccttttcacaacagctcaaagcaaag
ctggacttttttaagaccagcatacagtacgacttggagaaatacagtgatcagatgcag
tacggcatatcttcagaaaagatgctgaaggcttggcacgaaaatgaagagagggctgct
gcttttgcacaggtggcagagattggtcatctggatgaggaaataatggcgttgcattcg
gaaatcgttgagttacagagaagtccttatgctcgtcgtcaaggagatgtcatggagcag
ttgcaagagaaagccattgaactctacaaacagttgaaggcaaaatgcaaaatgccagac
cctcagcatggctacagcgacagctctgagatggtgaaggtcatagtacagactgtccag
aatcaagaccgggtgctaagagatctatatgcacacctcagtaaaatccctctgagtaag
cagaagatcatcgacctcttccctaaaatcgagagaacgctggaatgcataaaggaggca
gacaccacagtcatgcagatgcagatcaagagacagagagagttctggcacttactgaag
attgcctgtgcacaaaacaccacacggagctcagtgagtcagagcggagaaatgccctcc
tcgctgtctacttggaaccagactcaagcccagtgttcctcccgtctccccatgtccttg
caagtgccacacgagggtgattcagttaatcatttactggaggagaatcagcgttacttg
actcagctcaccagtttactgcaagaaaccaccgaggagaaatcagagagcataatggct
caggactggagctggacaaaatacgaatccctggttgctaaatcagcgcgtttgtag

DBGET integrated database retrieval system