KEGG   Danio rerio (zebrafish): 393323Help
Entry
393323            CDS       T01004                                 

Gene name
rtn4ip1
Definition
(RefSeq) reticulon-4-interacting protein 1 homolog, mitochondrial
  KO
K23164  reticulon-4-interacting protein 1, mitochondrial
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    393323 (rtn4ip1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    393323 (rtn4ip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C ELFV_dehydrog adh_short Semialdhyde_dh Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 393323
NCBI-ProteinID: NP_956646
ZFIN: ZDB-GENE-040426-1314
Ensembl: ENSDARG00000031366
Vega: OTTDARG00000032861
UniProt: Q7T3C7
Position
17
AA seq 359 aa AA seqDB search
MPAWVIDKYGKNDVLRFTKNAALPIIHYPNEVVVKVHAAGLNPIDISMRGGYGAATMAMK
RDPLNISQSGGEFPLILGRDVSGEIMECGLDVKYFKPGDQVWAAIPPWKQGSLAEFVVVS
GNEVSHKPKSLRHDEAASIPYVAATAWSAIVNTGGLNKDNSAKKRVLILGGSGGVGTFAI
QMVKAWGAHVTVTCSQNAERLVRDLGADDVVDYTAGPVEKQLKNLEKFDLILDSIGGETE
KWALDLLKPWSGAKFVTLITPFLQNTDRLGLADGMMQSAVTVGCKVVKNLRKGVHYRWGF
FAPSGSALDEVSEMVDAGKVRPVVEEVFSFAQVPEAFQKVEQGHARGKTVVSIMEDQKE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatgggtcattgataaatacgggaaaaacgatgtgttgaggttcaccaagaac
gcggcgcttccgatcatccactatcctaatgaagtggtggtaaaggtgcacgctgcgggt
ctcaacccaattgacatcagtatgaggggtggctatggagcagctactatggccatgaag
cgtgacccactgaacatcagccaatcaggtggtgaatttcctctcattctgggtcgagat
gtatccggagagatcatggaatgtgggctggatgtgaagtactttaaaccaggagatcag
gtgtgggctgctattcctccatggaagcagggcagtctggcagagtttgtagtggtcagt
ggcaatgaggtttcacataagcctaaatcactgaggcatgatgaagccgcatccatcccg
tatgtggctgcaacagcctggtctgccatcgtcaacaccggtggcctcaacaaagataac
tctgcaaaaaaacgtgttcttattctgggaggatcaggaggagtgggaacttttgcaata
cagatggtaaaggcctggggtgcacatgtgactgtaacatgttcccagaatgctgagcgg
ctggtgagagacctaggtgctgatgatgtcgtggactacactgctgggccagttgaaaag
cagctaaagaatttagaaaagttcgatttgattttagacagcattgggggtgaaactgaa
aaatgggccctagatcttcttaaaccctggagtggtgctaaatttgtgaccctgataaca
cctttcctgcaaaacacagaccgactgggccttgcggatggaatgatgcagtctgcagtc
actgtaggatgcaaagtggtgaagaacctcaggaaaggagtgcattatcgctggggtttc
tttgctccaagcggctctgcgctggacgaggttagcgaaatggttgacgctggaaaggtc
cgtccagtagtggaggaagtgttttcatttgctcaggtgccagaagcctttcagaaagta
gagcagggtcatgctcgaggaaaaactgtcgtctctatcatggaggaccagaaagagtaa

DBGET integrated database retrieval system