KEGG   Danio rerio (zebrafish): 393339Help
Entry
393339            CDS       T01004                                 

Gene name
slc5a12
Definition
(RefSeq) sodium-coupled monocarboxylate transporter 2
  KO
K14388  solute carrier family 5 (sodium-coupled monocarboxylate transporter), member 8/12
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    393339 (slc5a12)
Transporters [BR:dre02000]
 Solute Carrier Family (SLC)
  SLC5: Sodium glucose cotransporter
   393339 (slc5a12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF NdhL
Motif
Other DBs
NCBI-GeneID: 393339
NCBI-ProteinID: NP_956662
ZFIN: ZDB-GENE-040426-1343
Ensembl: ENSDARG00000005004
Vega: OTTDARG00000039563
UniProt: Q7T384
Position
25
AA seq 623 aa AA seqDB search
METVGRFQAGDYVVFACLFVVSSGIGVFFAIKERNKAPSKEFLVGGRQMSCGPVALSLTA
SFMSAVTVIGAPADVYRFGASYVIFGVAYTFVVFFTAELFLPVFYRSGITSTYEYLELRF
CKLVRVAATLIYIIQTILYTGVVVYAPALALNQVTGFDLWGSIFATGIVCTFYCTLGGLK
AVVWTDAFQMVVMVVGFLTVLIQGSSRAGGIENVWSTSRTGGRLQVFDFDVSPLRRHTFW
TLSVGGTFTWLGIYGVNQSTIQRCISCKTEGHARWALYLNLLGLWIILFCAVVSGLIMYS
YYSHCDPWSSGLISAPDQLMPYFVMEILGAFPGLPGLFVACAFSGTLSTVAASINALATV
MYEDFVSQCFPDLSNRAASWISKALCVAFGVACTTMAVAASYMGGIVQAALSIHGMCGGP
VLGLFSLGILFPFTNLKGAVGGLIVGISLSFWVGVGAFIYPAPSNNTHALELNTAGCNIT
AAAFEPTSATVTQLTSDRNWLADSWYSMSYLYYSAVGFIGTVAAGLLITLLTGPMDPKLL
KPGMTRSVKEVMCFCTEKFTEADLGEGKEDVGDFGKAWEKHPDQGCTLRMDEKFRCSCDN
QQENGNTNAGFDHNETSIVQKKL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgtgggcaggttccaggccggggattatgtggtgtttgcgtgtctgttcgtg
gtctcctccggcatcggcgtcttcttcgccatcaaggagagaaacaaagccccgtccaag
gagtttctggtggggggccgtcagatgtcctgcgggcccgtggctctgtccctcaccgcc
agcttcatgtctgctgtgactgtgatcggggctccggcagacgtctacagattcggggcc
tcgtacgttatcttcggggtcgcctacacgtttgtggtgttttttacggctgagctcttc
ctgcccgtgttttacaggtcaggaatcaccagcacatatgagtacttggagttgcgtttc
tgcaagctcgttcgcgtcgcagccactctaatttacatcattcagacgattctctacact
ggtgtggtggtttatgctcctgctttagctctcaatcaagtgacaggatttgacctttgg
ggatctatatttgccaccggcattgtctgcaccttttactgcacactgggtgggctgaag
gctgtggtatggaccgatgccttccagatggtggtgatggtggtgggcttcctcactgtg
ctgatccagggttcgagtcgagctggaggaatcgagaatgtctggagcacctctcgcact
ggaggacgattgcaggtgtttgactttgacgtgagtccgctcaggagacacacgttctgg
acactcagtgtcggaggaaccttcacctggctggggatttatggagtaaaccagtccaca
attcagagatgcatctcgtgtaaaacagaaggtcacgcacgctgggctctgtatctgaat
ctgctgggtctgtggattattctgttctgcgctgtggtttctggcctgatcatgtactct
tattactctcactgcgatccctggtcatctggactgatctctgcgccagatcagctcatg
ccatattttgtgatggaaatcctgggtgcgtttccgggactgccggggttatttgtggcc
tgtgccttcagcggcactctgagcacagtagccgccagtatcaatgctttggccacagtg
atgtacgaggactttgtgagccagtgtttcccagatctctccaaccgagcggccagctgg
atcagcaaagcgctctgtgtggcgtttggtgtggcctgcactactatggccgtggcggca
tcatacatgggaggaatcgtgcaggcggctctcagtatccatggcatgtgcggagggccg
gtgctgggcctgttttctctgggaatcctgtttccattcactaatctaaagggggcagtt
gggggtctgatcgtgggcatctctctctcgttctgggtcggcgtgggcgctttcatttac
ccagcacccagcaataacacgcatgctctggaactcaacactgcaggctgcaacatcaca
gctgctgcatttgagccaacatccgccacagtgacccagctcacctcagacaggaattgg
ctggcggattcgtggtactccatgtcctacctgtactacagtgcagtgggctttattggg
acggtggcggcaggtctgctcatcacactgctgacaggcccaatggacccgaaactgttg
aaaccagggatgactcgatcagtgaaggaggtcatgtgtttctgcactgagaaattcaca
gaagctgaccttggtgaaggcaaagaggatgtgggagactttggcaaggcatgggagaaa
catccagaccagggatgcaccttaagaatggacgagaagttcaggtgcagttgcgataac
caacaggaaaatggtaacactaatgccggctttgaccataacgaaactagcatagttcag
aaaaagctgtaa

DBGET integrated database retrieval system