KEGG   Danio rerio (zebrafish): 393373
Entry
393373            CDS       T01004                                 

Gene name
zgc:63882
Definition
(RefSeq) uncharacterized protein LOC393373
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: MMtag TFIIF_alpha
Other DBs
NCBI-GeneID: 393373
NCBI-ProteinID: NP_956696
ZFIN: ZDB-GENE-040426-1286
Ensembl: ENSDARG00000004525
UniProt: F1QZ61
Position
2
AA seq 306 aa
MFGSSRSGGVRGGQDQFNWDDVKVDKHRENYLGNSLMAPVGRWQKGKDLTWYAKDKKSGK
ALTKEQEMEAVREAEHEAMLAALGHKTIKRQPTGLTKEDLADVCRREGEGEERDVDRVSG
LGSSRSGPRGMPLSRQEKEAVKMGLPVFTHHKSDRSQEASQRPEEDSKPDKADKRSDSKK
KNKKEKKSKKEKKKKKEKRKHRSRSESSDSDSEINSKRCVFVLSFRRRKDPRDHHSPNPS
RSSQSGAGARDRHSGGGPKAERRTPTPPPQRHRRRHDTDSSSEGHSAGRRTLKQTHRRRH
DSSSDH
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtttggctcgtcgagatctggaggggtgagaggcggccaggaccagttcaactgggat
gatgttaaagtggataaacacagagagaactacttggggaactccctcatggcaccggtt
ggacggtggcagaaaggcaaggatttgacctggtatgctaaagataagaagagtggtaaa
gctctgactaaagagcaggagatggaggctgtacgcgaggcagagcatgaggccatgctg
gcagcactaggtcataaaaccatcaagaggcagccaactggactcactaaagaggatcta
gcagacgtgtgcaggagggaaggagagggcgaggagcgggacgtagacagggtttctgga
ctcggaagctccaggtccgggcccagaggaatgccgctgtctaggcaggaaaaagaggct
gtcaaaatgggtttgccggtttttacgcatcacaaatctgacagatcgcaagaagccagt
cagaggccagaggaggacagcaaacctgataaagcagataaaaggtccgacagcaaaaag
aaaaacaaaaaggaaaagaagagcaagaaggagaaaaagaaaaagaaagagaaaaggaag
cacagaagcaggagcgaatcttcagattccgactctgaaatcaacagtaaaaggtgtgtt
tttgtgctctccttcaggcggagaaaagatccccgggaccaccacagtcctaatccatca
aggagcagtcagagtggagccggggcccgtgacaggcattcaggaggggggccaaaggcc
gagcgcaggaccccgaccccccctccacagcgccaccgccgccgacacgacaccgactca
tcctctgagggacacagcgcagggcggcggacccttaaacaaactcaccggcggcgccat
gatagcagctcagaccactga

DBGET integrated database retrieval system