KEGG   Danio rerio (zebrafish): 393421Help
Entry
393421            CDS       T01004                                 

Gene name
etnppl
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    393421 (etnppl)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     393421 (etnppl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 393421
NCBI-ProteinID: NP_956743
ZFIN: ZDB-GENE-040426-1133
Ensembl: ENSDARG00000035544
UniProt: Q7SY54
Position
7
AA seq 492 aa AA seqDB search
MATETLDKQKTIDLRKKHVGPSCKVFFDHDPIKIVRAKGQYMYNEKDEKYLDCINNVAHV
GHCHPDVVSAGAKQMELLNTNSRFLHDSLVLYAQRLQATLPEKLSVCYFVNSGSEANDLA
LRLAWQYTGHKDIITLDNAYHGHVSSLIDISPYKFHQMAGAEPSQHVHVALSPDTYRGKY
REDHPDPATAYAENVKEVIEEAHKKGHEIAAFIAESLQSCGGQVIPPMGYFQKVAQHVRN
AGGIFIADEVQVGFGRVGTHFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVITSREIAES
FMSSGMEYFNTFGGNPVSCAIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKKRHPLVG
DVRGRGLFVGLELVRNQSKRTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFS
REDAEFAVEKIDQILTDLEKAMVLQRPEAAILETGHIKRKDASDENGLVHPSNGNSHKHT
STIPLSKKTKRN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggaaactttggataagcagaagactatagatctccgaaagaaacatgttggt
ccatcctgcaaagtgttcttcgatcatgatcctatcaagattgtgcgagcaaagggccag
tatatgtacaacgaaaaagatgagaaatacctggactgcataaacaacgtagcacatgtg
ggtcactgccacccagatgtggtcagtgcgggagcaaagcaaatggagcttctcaacacc
aattcccgtttcctgcatgacagtctggttctttatgctcagcggcttcaagccaccctt
cccgaaaagctctctgtgtgctattttgtcaactcagggtctgaggcaaatgatctggcc
ctgaggctggcttggcagtacactgggcacaaagacatcatcacactggataatgcctac
catggtcatgtgtcatcactcattgatatcagtccatataagtttcatcagatggctggg
gcagagccgagccaacatgtgcacgtggctcttagtccagacacctatagaggcaaatat
cgtgaagaccacccagaccctgccactgcttatgctgaaaatgtcaaggaagtaatcgaa
gaggcccataaaaagggacatgagattgctgcttttattgctgaatcactacaaagttgt
ggaggacaggtcattcctccaatgggttacttccaaaaagtggcacagcatgtgagaaac
gctggaggcattttcattgctgatgaggtccaggtgggctttggaagggtggggactcac
ttctggggctttcagctacagggagaagattttgtaccagatattgttacaatgggcaaa
cctattggaaatggccatccaatgtcatgcgtgatcaccagcagagagattgctgaaagc
ttcatgtcttctggaatggagtacttcaacacatttggcggtaaccctgtatcatgtgct
attgggttggcggtgcttaatgtaattgagaaggaagatctccaaggcaatgccctgcat
gtcggaggttacctgactcagcttttggaagacctgaagaaaagacaccccttggtcggt
gatgtgaggggacgtggcctatttgttgggttggagctggtcagaaatcagagtaaaagg
acccctgctacagctgaagctcaggaggttatttacaggctaaaagaacagcggattctg
ctcagtgctgatggtccacaccgcaacgttctgaagttcaagcctcccatgtgcttctcc
agagaggatgctgaattcgcagtggagaagattgatcaaattctgacagacttggaaaag
gcgatggttctccaaaggcctgaagcagcaatcttggagactggacacattaagagaaag
gacgccagtgatgaaaatggccttgtacatccttcaaatggcaacagccacaagcacacc
agtacaatacctctgagcaaaaaaactaaaagaaattaa

DBGET integrated database retrieval system