KEGG   Danio rerio (zebrafish): 393503
Entry
393503            CDS       T01004                                 

Symbol
mfsd4aa
Name
(RefSeq) major facilitator superfamily domain-containing protein 4A
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 393503
NCBI-ProteinID: NP_956825
ZFIN: ZDB-GENE-040426-1643
Ensembl: ENSDARG00000023768
Vega: OTTDARG00000042591
UniProt: Q7SXB7
Position
11
AA seq 526 aa
MTYLLNERICALFRSNWQHTLTYWSVFFSFGLCVAFLGPTILDLRCQTQSTLQEITLVFF
SQQFFLFLGSTIGGFFSKTLVSSLSSLAVSTLIISVVFAIIPLCRELLMLAFAMAVSGLA
MGTIDTISNLQLVKIYQKDSTVFLQALHFFVGLGALVSPLIADPFLSDTSCVIGNSSVNT
TSLEDLRNKLAGRHVHNVSNVHLHTDGEVVTNVSYAFWIMAIINLPVPIAIFVLVYRERL
FMCGSDPSRRLLDGDVLAIKPRGTSILAEDTGQKETSNSHADLFSCCLLGKAHSFPLSFF
GIHVLGGLVLFFSDGIVGSYTGFVYTYAVAPPMNLPHKTAGYLTCIFWAAITTGRLSAIP
LSYRFKPVRLLIVSQVGVIVTVLLLLIFSNSSVFLFIGTCCLGLFISSIFPCMLALTEDI
LEYKGCATTVLVTSAGMGEMVLQVLVGSVMHSRGSFSFLLCGMIFGCLGFTFFTFLYFVQ
QSHKSYTEALPGNSPVERHEENGIKTCSAAVLNSWDAPEHKTSLDP
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgacttatctgctcaacgaacggatctgcgcgttattccgcagtaactggcagcatact
cttacatactggagtgttttcttcagttttggactgtgtgtcgcttttttgggtccgacc
atcctggacctgaggtgtcaaactcagtccactttacaggagatcactctggtcttcttt
tcccagcagtttttcctctttcttggaagcacaattggaggattcttcagtaaaacgctt
gtaagttcgctgtcatctctggctgtatccaccctcattatctctgtggtttttgccatc
atcccattatgccgcgagcttctcatgttggcgtttgccatggcagtgtctggtctcgcc
atgggcaccatcgacaccatctctaacctgcagctggtcaagatctaccagaaagactcc
accgttttcctgcaggctctccacttttttgtgggtctcggggcgttagtgagtcccctt
attgctgacccttttctgtctgacaccagctgtgtgatcggcaacagcagcgtcaacaca
acatcattagaagatctgaggaacaagctggcgggcagacatgtgcacaacgtgtccaac
gtccaccttcacaccgacggagaggtggtgaccaacgtctcctacgccttctggatcatg
gctatcatcaatcttccagtgcccatcgcgatattcgtcctggtatatcgagagcggttg
ttcatgtgtggatcagaccccagtcgacgtttactagacggagacgtgttggcaataaaa
ccccggggaacatccatcctggcagaagacaccggccagaaagagacatccaacagtcac
gcagacttgtttagctgctgtctgcttggcaaagcacacagtttcccgctgtctttcttc
gggatccacgtcctcgggggtctggtgctcttcttttctgatggtatagtgggctcatac
accggctttgtgtacacgtatgcagtggcgccccctatgaatctgcctcacaagacagcc
ggatatttgacttgcatcttctgggctgcaatcaccaccggccgactgtctgctattcct
ctgtcctaccgcttcaaacccgtccggctgctcatcgtcagtcaggtgggagtgatcgtc
acagttcttctgctgctcatcttctccaacagcagtgtttttctcttcatcggcacctgc
tgtctcggcctgtttataagcagtatcttcccctgcatgctggcgctcactgaagacatc
ctggagtataaaggctgtgccaccacggtgctggtgaccagtgcaggaatgggcgagatg
gtgctccaggtgctcgtgggttcggtgatgcacagtcggggcagcttcagtttcctgctg
tgtgggatgatcttcggctgcctgggattcactttcttcacttttctctacttcgtccag
cagagtcataaaagctatacggaagctttgcccggtaactctcctgtggaacgacatgag
gaaaatgggatcaagacctgctctgctgcggtcctgaactcatgggacgcaccagagcac
aaaacatccctggatccataa

DBGET integrated database retrieval system