KEGG   Danio rerio (zebrafish): 393544
Entry
393544            CDS       T01004                                 

Gene name
psmd3
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    393544 (psmd3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dre03051]
    393544 (psmd3)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     393544 (psmd3)
SSDB
Motif
Pfam: Rpn3_C PCI CSN8_PSD8_EIF3K TPR_2
Other DBs
NCBI-GeneID: 393544
NCBI-ProteinID: NP_956866
ZFIN: ZDB-GENE-040426-1444
Ensembl: ENSDARG00000018124
Vega: OTTDARG00000037719
UniProt: Q6NYV1
Position
19
AA seq 503 aa
MKEATAKRREKPKEKNTAEPQDVEMKEEEQRGARELDQTTLDDIREHVKQIEKAVSGKEP
RFVLRALRALPSTSRRLNTNVLHKAVSGFFTANAAGKEFLLGFLEQPVEIEGDVPFRPRT
GKAAAVPLIPEVEAYLQLLTVVYLTNNKHYTEAQKVSDDLLQKIGSQNRRALDLVAAKCY
YYHSRVYEFLNQLDVVRSFLHTRLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLV
SKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKL
LIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGT
YTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASI
NHEKGFVQSKETMDIYSTREPQLAFHQRIAFCLDIHNMSVKAMRFPPKAYNKDLESAEER
REREQQDLEFAKEMAEDDDDSFP
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaaagaggcgacggcgaagagacgagagaaaccgaaggagaaaaacaccgcagagccg
caggatgtggagatgaaggaggaggagcagcgcggggcccgggaactggaccagaccact
ctggacgatatccgggaacatgtgaagcagatcgagaaggcggtgtcggggaaggagccg
cggttcgtcctgcgggctctgcgggcgctgccctccaccagccgccgcctcaacacaaac
gtcctgcataaagccgtcagcgggttcttcacagcaaacgccgccgggaaagagtttctg
ctcggcttcctggagcagccggtggagattgagggcgacgtgccgttcagaccacgcacc
ggtaaagctgccgcggtgccgctgatccctgaggttgaggcgtacctgcagctgctgacg
gtggtgtacctgaccaacaacaaacactacacagaggctcagaaagtctcagatgatctc
cttcagaagatcggctctcagaaccgccgtgcgctggatctggtggccgctaagtgctac
tattatcactcacgtgtgtatgagttcctgaaccagctggacgtggtgcgcagtttcctg
cacacgcggctgcggacggccacgctgcgccacgatgcggacggtcaggccacgctgctc
aacctgctgctgcgcaactacctgcagtacaacctgtacgaccaggcagagaagctggtg
tccaaatctgtgttccccgagctggccaataacaacgagtgggcacgctacctgtactac
acaggccgcatcaaagccatccagctggagtactcagaggccaggaggaccctgaccaac
gccctgcgcaaagcccctcagcacaccgccgtgggcttcaagcagactgttcacaagctg
ctgatcgtggtggagctcctgctgggggagattcctgaccgtcttcagtttcggcagccg
tcgctcaagcgctcgctgatgccctacttcctgctcacacaagccgtgagaactggaaat
ctggccaagtttaaccaggtcctggatcagtttggagagaagttccagaccgacggcacg
tacacactgatcatccgactgagacacaacgtcattaaaactggcgtgaggatgatcagt
ctgtcgtactcgcgcatctctctggctgatattgcacagaagctgcagctcgacagtcct
gaagacgcagagttcatcgtggccaaggcgatccgtgacggtgtgatcgaggccagcatt
aatcatgagaagggcttcgtgcagtcgaaggagacgatggacatctacagcacacgagag
ccgcagctcgccttccaccagcgcatcgccttctgcctcgacatacacaacatgtctgtg
aaggcgatgcgttttcctccgaaggcctacaataaagatctggagtctgcagaggagagg
cgtgagcgggagcagcaggatctggagttcgctaaggagatggcagaagatgatgatgac
agcttcccctga

DBGET integrated database retrieval system