KEGG   Danio rerio (zebrafish): 393545Help
Entry
393545            CDS       T01004                                 

Gene name
onecut1
Definition
(RefSeq) hepatocyte nuclear factor 6
  KO
K08026  one cut domain, family member 1, hepatocyte nuclear factor 6
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: CUT Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 393545
NCBI-ProteinID: NP_956867
ZFIN: ZDB-GENE-040426-1469
Ensembl: ENSDARG00000007982
Vega: OTTDARG00000013397
UniProt: Q6PHC9
Position
18
AA seq 461 aa AA seqDB search
MNAQLSMENIGDLHGVSHEPVHSAADLMTGDSAHHRSHRSSLSAHARSMGMASILDSGDY
HHHRPPEHPGLATHLHPAMSMACEAPPGMSMSSTYTTLTPLQPLPPISTVSDKFPHHHHH
HHHHHHHPHQRIPGNVSGSFTLMRDDRGLAPMNNLYSPYHKDVASMGQSLSPLSGSGLSG
IHNSQQGLPPYAHPGATMPAEKMLTPNGFEAHHPAMLARHGEQHMSASSASMVPINVIHH
HPHAHLNAQGHGQVLGSTREQNHSSVPGSQLNNGSSSGQMEEVNTKEVAQRITTELKRYS
IPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAG
ERTIACKRKEQEHGKGERGNISKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLG
LELATVSNFFMNARRRSLDKWLDDGSSNSANSSSSSTCTKA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccagctgtcgatggagaacattggcgatctgcacggagtgagccatgaaccg
gtccacagcgcggcggatctcatgaccggagacagcgctcatcacaggagtcatcggagc
agtctgtcagcccatgcgcgctccatgggcatggcttcaatcctggacagcggcgactat
catcaccaccggcccccggagcatcccgggctcgccacgcacctgcacccggccatgagc
atggcatgcgaggctccccccgggatgagcatgagcagcacctataccaccctcactccg
ctgcagcctttaccgcccatctccaccgtctccgacaaatttccgcaccaccatcatcat
caccaccaccaccatcaccacccgcaccaaaggatcccggggaacgtcagcgggagcttc
accttgatgagggacgataggggtctggctccgatgaacaacctctactctccctaccac
aaggatgttgccagtatgggacagagcctttcgcccttgtctggatccggactgagcggc
attcacaactcgcagcaggggctgccgccgtacgcgcaccccggggccaccatgcccgcc
gagaagatgcttacacccaacggattcgaggcacatcaccccgcgatgttggctcgacac
ggggagcagcacatgagcgcgtcttcggcgagcatggtgccgatcaacgtcatccaccat
cacccgcacgcccatctcaacgcccagggccacggacaggtgctgggctccactcgggag
cagaaccactcctccgttcccggatcgcagctcaacaacggtagcagttcgggtcagatg
gaagaggtcaataccaaagaagtggcccaaaggatcaccactgaactcaaaagatacagc
attccacaggccatcttcgcccagagggtgctgtgtcgctcgcaagggacgctttcggac
ctgctccggaaccctaagccctggagcaagctcaagtctggtcgggaaaccttccgtagg
atgtggaaatggttgcaggagcctgagtttcagagaatgtccgcgctcaggctcgcaggt
gagagaacaatagcgtgcaaacgaaaggagcaggagcacggtaaaggcgagcggggaaac
atctccaagaagccccggttggtcttcaccgatgtccagcgtcggactttacatgcaata
ttcaaagagaacaagcgtccgtccaaagagttacaaatcaccatctctcagcagctgggc
ctggagctcgccaccgtcagcaactttttcatgaacgcgcgtcgacggagcctcgataag
tggctggacgacggcagctccaactcggccaactcctcctcctccagcacttgtaccaaa
gcatga

DBGET integrated database retrieval system